(data stored in ACNUC16935 zone)

EMBL: BN001307.PE253

BN001307.PE253       Location/Qualifiers
FT   CDS             complement(join(699220..699463,699517..699612,
FT                   699665..700278,700339..700911))
FT                   /locus_tag="ANIA_01427"
FT                   /old_locus_tag="AN1427.4"
FT                   /product="DUF895 domain membrane protein (AFU_orthologue;
FT                   AFUA_8G04110)"
FT                   /note="transcript_id=CADANIAT00008039"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008039"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008039"
FT                   /db_xref="GOA:Q5BDF3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF3"
FT                   /protein_id="CBF84836.1"
FT                   /translation="MATVNEKAAPLSTTDPEVQQDSQRLPGKPWMYKNLKLGPLTVPYY
FT                   ASPQFQLVLVAFVCFLCPGMYNSVNGLGGAGQLNHSDISKSNTATYSTFAVVGFFAGSI
FT                   ANRIGLRLTLSFGGFGYTLYVAALLCYNHTYNSGFLIFAGALLGLCAGLLWCAQGAVMM
FT                   AYPGENEKGKFISIFWVIFNLGGVIGGLIPLGQNIHNSDSAGSVNDGTYIAFMVLMVLG
FT                   FLLAWGLVDSKNIVRKDGTRVIAIKNPSWKSELLGLYETLLTDWYIVAFFPMFLASNWF
FT                   YSYHFNAINGSYFVPRAAALNSILYWAMQMIGAFCFGLILDLKSLKRPARAKLVWVLLF
FT                   TITMGVWGGGYAFQKTYTRETAGRSKDWNQSGYIGPMFLYMFYGFYDAAFQTCAYWFMG
FT                   CLSNNSRKLANFAGFYKGIQSAGAAITWALDFNETPYMNMFASCWGILCGSLLIASPII
FT                   FFKIKDHTDLEEDLKFSDETVADVTGIEVGDVTLRPQQQHTPEKRSPSDA"
     MATVNEKAAP LSTTDPEVQQ DSQRLPGKPW MYKNLKLGPL TVPYYASPQF QLVLVAFVCF        60
     LCPGMYNSVN GLGGAGQLNH SDISKSNTAT YSTFAVVGFF AGSIANRIGL RLTLSFGGFG       120
     YTLYVAALLC YNHTYNSGFL IFAGALLGLC AGLLWCAQGA VMMAYPGENE KGKFISIFWV       180
     IFNLGGVIGG LIPLGQNIHN SDSAGSVNDG TYIAFMVLMV LGFLLAWGLV DSKNIVRKDG       240
     TRVIAIKNPS WKSELLGLYE TLLTDWYIVA FFPMFLASNW FYSYHFNAIN GSYFVPRAAA       300
     LNSILYWAMQ MIGAFCFGLI LDLKSLKRPA RAKLVWVLLF TITMGVWGGG YAFQKTYTRE       360
     TAGRSKDWNQ SGYIGPMFLY MFYGFYDAAF QTCAYWFMGC LSNNSRKLAN FAGFYKGIQS       420
     AGAAITWALD FNETPYMNMF ASCWGILCGS LLIASPIIFF KIKDHTDLEE DLKFSDETVA       480
     DVTGIEVGDV TLRPQQQHTP EKRSPSDA                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page