(data stored in ACNUC16935 zone)

EMBL: BN001307.PE257

BN001307.PE257       Location/Qualifiers
FT   CDS             join(709782..710632,710664..710772)
FT                   /locus_tag="ANIA_01431"
FT                   /old_locus_tag="AN1431.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008043"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008043"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008043"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE9"
FT                   /protein_id="CBF84843.1"
FT                   /translation="MAILDKDRPRGLRVPSLSSFRSKHKSPESTPTIHLPSPSQMTLQN
FT                   ESIPVSSFKPAEKALPPQPLPSAPQPSSAAGYPYPYPPQTYNNPPTPVSVQNSTPTRPF
FT                   GHDGPAQPPLPALPADRPMPRPIPQSTTPPARRPIPRSTAASTTAPAPAPAPEPAPEPA
FT                   PEPVPAQTSTPVYAPAPIPAPSSVPPVNNLIAQQRTPPLSEGGPEQRKSNGTSDSLEDL
FT                   IPSPEPEPELDGASSTPNETGSSEEDNRPFTPPEVEPVAVPLTKLHYACYQDHRAMPAT
FT                   GNVNSIVRSVTDAFFAACVFAPIVIKRCKNALAVRWHS"
     MAILDKDRPR GLRVPSLSSF RSKHKSPEST PTIHLPSPSQ MTLQNESIPV SSFKPAEKAL        60
     PPQPLPSAPQ PSSAAGYPYP YPPQTYNNPP TPVSVQNSTP TRPFGHDGPA QPPLPALPAD       120
     RPMPRPIPQS TTPPARRPIP RSTAASTTAP APAPAPEPAP EPAPEPVPAQ TSTPVYAPAP       180
     IPAPSSVPPV NNLIAQQRTP PLSEGGPEQR KSNGTSDSLE DLIPSPEPEP ELDGASSTPN       240
     ETGSSEEDNR PFTPPEVEPV AVPLTKLHYA CYQDHRAMPA TGNVNSIVRS VTDAFFAACV       300
     FAPIVIKRCK NALAVRWHS                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page