(data stored in ACNUC16935 zone)

EMBL: BN001307.PE258

BN001307.PE258       Location/Qualifiers
FT   CDS             complement(join(711140..712102,712173..712274))
FT                   /locus_tag="ANIA_01432"
FT                   /old_locus_tag="AN1432.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_8G04200)"
FT                   /note="transcript_id=CADANIAT00008044"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008044"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008044"
FT                   /db_xref="GOA:Q5BDE8"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="InterPro:IPR039249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE8"
FT                   /protein_id="CBF84845.1"
FT                   /translation="MAAEEDEVDYMSMVIEEPQQKETFTQKKRRLQREAEARARVPSKA
FT                   ERAAQEAAKRDAALATSTLNPSNKGFQMMAKLGFKPGQTLGKPAGEDREKEGSGPNAQS
FT                   RTEPLNLIFKEDRGGIGLDSERKRKIREEAEEAAKKIKAEEGDYRDRVRLERETKRIEA
FT                   QIHAAQKVAERLDADENGEADLFSASNVEDKDKNEEKDEKEQEGSDEEAPATKPKAKAK
FT                   VKPTSQINILYRGLVREREEKERAIQTRHMLQTSLPTSFFPNPRLPGYEDATLDRDDHE
FT                   ALGGGRDLSTVLEQEVEEEDPELDEFNTLEPAERLRRLVEYLREKHNYCFWCKYRYDTA
FT                   EMEGCPGVTEEDHD"
     MAAEEDEVDY MSMVIEEPQQ KETFTQKKRR LQREAEARAR VPSKAERAAQ EAAKRDAALA        60
     TSTLNPSNKG FQMMAKLGFK PGQTLGKPAG EDREKEGSGP NAQSRTEPLN LIFKEDRGGI       120
     GLDSERKRKI REEAEEAAKK IKAEEGDYRD RVRLERETKR IEAQIHAAQK VAERLDADEN       180
     GEADLFSASN VEDKDKNEEK DEKEQEGSDE EAPATKPKAK AKVKPTSQIN ILYRGLVRER       240
     EEKERAIQTR HMLQTSLPTS FFPNPRLPGY EDATLDRDDH EALGGGRDLS TVLEQEVEEE       300
     DPELDEFNTL EPAERLRRLV EYLREKHNYC FWCKYRYDTA EMEGCPGVTE EDHD             354
//

If you have problems or comments...

PBIL Back to PBIL home page