(data stored in ACNUC16935 zone)

EMBL: BN001307.PE26

BN001307.PE26        Location/Qualifiers
FT   CDS             complement(join(70747..71147,71209..71276,71323..71830,
FT                   71883..71919,71962..72153))
FT                   /locus_tag="ANIA_09036"
FT                   /old_locus_tag="AN9036.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007817"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007817"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007817"
FT                   /db_xref="GOA:Q5ARP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP4"
FT                   /protein_id="CBF84417.1"
FT                   /translation="MGVTSTVCEIPPRNRKSTQLAVGWIFIVLTTLALGLRLMARPPLS
FT                   ASFGIDDGIGIGTYVQLLSCTALVDMILMIQGANLGWGTDMWALQAEQIILQMKVDANL
FT                   QPIFILFTNNSTLCQLFYAGIIAFYLSVSLAKLSILFFYLRIFTTDTFKRIAYTMIFLC
FT                   SAYGVGSVVTSILDCMPPSYFWTRFDGVSTGYCVSKAAFKVIPPVNIALDVVVMVLPLP
FT                   LLARLNLPLQKKIRVLSMFSMGVLIIVADILRITHLFHSITAYNITYNGGELSYFGVIE
FT                   SGVGVICICMPAIAALLKRVLPQCFGSLAKRSYLYRTINSRSNTEFGASRSRSQRGAIQ
FT                   PSAYAHTNPNNPVSFSAIAWGAREDERDGDGNTSDIHLTLLPATEIADERIQRPQKALT
FT                   SR"
     MGVTSTVCEI PPRNRKSTQL AVGWIFIVLT TLALGLRLMA RPPLSASFGI DDGIGIGTYV        60
     QLLSCTALVD MILMIQGANL GWGTDMWALQ AEQIILQMKV DANLQPIFIL FTNNSTLCQL       120
     FYAGIIAFYL SVSLAKLSIL FFYLRIFTTD TFKRIAYTMI FLCSAYGVGS VVTSILDCMP       180
     PSYFWTRFDG VSTGYCVSKA AFKVIPPVNI ALDVVVMVLP LPLLARLNLP LQKKIRVLSM       240
     FSMGVLIIVA DILRITHLFH SITAYNITYN GGELSYFGVI ESGVGVICIC MPAIAALLKR       300
     VLPQCFGSLA KRSYLYRTIN SRSNTEFGAS RSRSQRGAIQ PSAYAHTNPN NPVSFSAIAW       360
     GAREDERDGD GNTSDIHLTL LPATEIADER IQRPQKALTS R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page