(data stored in ACNUC16935 zone)

EMBL: BN001307.PE260

BN001307.PE260       Location/Qualifiers
FT   CDS             complement(join(715168..717621,717674..717961))
FT                   /locus_tag="ANIA_01434"
FT                   /old_locus_tag="AN1434.4"
FT                   /product="rRNA maturation protein (Nop14), putative
FT                   (AFU_orthologue; AFUA_8G04220)"
FT                   /note="transcript_id=CADANIAT00008046"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008046"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008046"
FT                   /db_xref="GOA:Q5BDE6"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE6"
FT                   /protein_id="CBF84849.1"
FT                   /translation="MPPSQLKQLKASLRDTGLLGPQKSKKQKRQNAKTGANAQNRAQRE
FT                   SALNAIRERFNPFEIRTVSRGKFDVTTRDGGAKSASGNFRPGVTKSLGEERRRQTLLQE
FT                   MDRRNKVGGIMDRRFGENDPTMTPEERAAERFARASQKKLRKDSMFNLEEDDEEEFTLT
FT                   HKGESLSFGDEDGIRDDFQEDLDAGDMSDTEMPRKRKRFIDDPEAEEDGSQDGEDVPER
FT                   KKSKHEVMQEVIAKSKFYKAQRQMAKEDDDELREELDKGLPELFDMLRGVKPPPKQEPP
FT                   KDDLAGMNPDRAAIMQGHSQGDPEKEYDQRLKQLTFDKRSMPTDRTKTEEEKAEEEAQR
FT                   LKKLEEERIRRMRGEDVSEDEAEAAEEEEDGEESEEESLPDDAKDFGLQQPTNYSTSRP
FT                   EGVDDEDDFILDDLVETRSDVSLSFVEDDEDIIGSEEESEDEEEEDELINGITMPGEES
FT                   GNEAPAPDTQIAGDGLAYTYPCPNSHEEFLKTIKDISYEDLPTVIQRIRALHHPRLHSD
FT                   NKVKLGRFAGILVQHAAYMVEQPQRPPFAVVENVLRHIHSLAKSHPESVSLAFRAQLRE
FT                   VAADRPLSLRPGDLVILTGIATIFPTSDHFHAVSTPAHLCLARYLGQGPVNSLSDLCTG
FT                   TYAASLALQYQTISKRYMPEFLNYVLNALCILSPGEPSSKLGSFPLRQPTELLRIRPSK
FT                   PLNIRKLQFLDVSARSEIDPEDLKLSLITTLSSLLNTASDLWSSKSASVEIFNQAQAVL
FT                   QHVSSSCVDVNKKAKKAKNPLIPAAALDTLQSTLDKLSTVLSQSRLTRRPLLLHNHRPL
FT                   AVKTAIPKFEDSFNPDKHYDPNRERAEVNRLKAEYKRERKGAMRELRKDANFIAREKLR
FT                   EKKEKDAEYERKYKRLVAEVQNEEGREANAYEREKRMRQGKR"
     MPPSQLKQLK ASLRDTGLLG PQKSKKQKRQ NAKTGANAQN RAQRESALNA IRERFNPFEI        60
     RTVSRGKFDV TTRDGGAKSA SGNFRPGVTK SLGEERRRQT LLQEMDRRNK VGGIMDRRFG       120
     ENDPTMTPEE RAAERFARAS QKKLRKDSMF NLEEDDEEEF TLTHKGESLS FGDEDGIRDD       180
     FQEDLDAGDM SDTEMPRKRK RFIDDPEAEE DGSQDGEDVP ERKKSKHEVM QEVIAKSKFY       240
     KAQRQMAKED DDELREELDK GLPELFDMLR GVKPPPKQEP PKDDLAGMNP DRAAIMQGHS       300
     QGDPEKEYDQ RLKQLTFDKR SMPTDRTKTE EEKAEEEAQR LKKLEEERIR RMRGEDVSED       360
     EAEAAEEEED GEESEEESLP DDAKDFGLQQ PTNYSTSRPE GVDDEDDFIL DDLVETRSDV       420
     SLSFVEDDED IIGSEEESED EEEEDELING ITMPGEESGN EAPAPDTQIA GDGLAYTYPC       480
     PNSHEEFLKT IKDISYEDLP TVIQRIRALH HPRLHSDNKV KLGRFAGILV QHAAYMVEQP       540
     QRPPFAVVEN VLRHIHSLAK SHPESVSLAF RAQLREVAAD RPLSLRPGDL VILTGIATIF       600
     PTSDHFHAVS TPAHLCLARY LGQGPVNSLS DLCTGTYAAS LALQYQTISK RYMPEFLNYV       660
     LNALCILSPG EPSSKLGSFP LRQPTELLRI RPSKPLNIRK LQFLDVSARS EIDPEDLKLS       720
     LITTLSSLLN TASDLWSSKS ASVEIFNQAQ AVLQHVSSSC VDVNKKAKKA KNPLIPAAAL       780
     DTLQSTLDKL STVLSQSRLT RRPLLLHNHR PLAVKTAIPK FEDSFNPDKH YDPNRERAEV       840
     NRLKAEYKRE RKGAMRELRK DANFIAREKL REKKEKDAEY ERKYKRLVAE VQNEEGREAN       900
     AYEREKRMRQ GKR                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page