(data stored in ACNUC16935 zone)

EMBL: BN001307.PE261

BN001307.PE261       Location/Qualifiers
FT   CDS             complement(join(718225..718351,718548..718574,
FT                   718640..718659,718733..718774))
FT                   /locus_tag="ANIA_11302"
FT                   /old_locus_tag="AN11302.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008047"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008047"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008047"
FT                   /db_xref="GOA:C8VM49"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM49"
FT                   /protein_id="CBF84851.1"
FT                   /translation="MLLEEVAKAVDKRSIYDVLCGVPAGYVFKYEKKYTIFCALINYLV
FT                   IVAVVLDLSQPVHLLEVGSNSAHGKE"
     MLLEEVAKAV DKRSIYDVLC GVPAGYVFKY EKKYTIFCAL INYLVIVAVV LDLSQPVHLL        60
     EVGSNSAHGK E                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page