(data stored in ACNUC16935 zone)

EMBL: BN001307.PE262

BN001307.PE262       Location/Qualifiers
FT   CDS             complement(join(719464..720442,720492..720604))
FT                   /locus_tag="ANIA_01435"
FT                   /old_locus_tag="AN1435.4"
FT                   /product="origin recognition complex subunit 3, putative
FT                   (AFU_orthologue; AFUA_8G04240)"
FT                   /note="transcript_id=CADANIAT00008048"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008048"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008048"
FT                   /db_xref="GOA:Q5BDE5"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE5"
FT                   /protein_id="CBF84853.1"
FT                   /translation="MSHFFANPISVLLADRVGEDLQNDKLCEAIRNVPSFREYCEILLE
FT                   DSKTQQVRDLLEDDKLLLLETTRLIRAGQRSMHYMFQAVKFISILLKELNISKKVSISE
FT                   LSIRALCGELQKSPLLEDVLAAFRRLDSSRVAGLLSQFPEALRSLPDLRGVEADFRSLT
FT                   KAHEGPEPLRSEYDSQNSVIGTTIVKQRVKLDTGKAKLPEETIKYTRIINRCCTLLRSY
FT                   FVNILVFPQELPLHEAFLLDMRNPIKEVFAPRARYAIERALSNPFDYLLFTSQDTERKI
FT                   SAKQPPTAILYQLYLESGALVNMYDLWTAFYAVFESEQGDSCDERMTMALFYRALSELR
FT                   ALGMLKHSRKKLDHVAKSAWKGL"
     MSHFFANPIS VLLADRVGED LQNDKLCEAI RNVPSFREYC EILLEDSKTQ QVRDLLEDDK        60
     LLLLETTRLI RAGQRSMHYM FQAVKFISIL LKELNISKKV SISELSIRAL CGELQKSPLL       120
     EDVLAAFRRL DSSRVAGLLS QFPEALRSLP DLRGVEADFR SLTKAHEGPE PLRSEYDSQN       180
     SVIGTTIVKQ RVKLDTGKAK LPEETIKYTR IINRCCTLLR SYFVNILVFP QELPLHEAFL       240
     LDMRNPIKEV FAPRARYAIE RALSNPFDYL LFTSQDTERK ISAKQPPTAI LYQLYLESGA       300
     LVNMYDLWTA FYAVFESEQG DSCDERMTMA LFYRALSELR ALGMLKHSRK KLDHVAKSAW       360
     KGL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page