(data stored in ACNUC16935 zone)

EMBL: BN001307.PE263

BN001307.PE263       Location/Qualifiers
FT   CDS             722166..724751
FT                   /locus_tag="ANIA_01436"
FT                   /old_locus_tag="AN1436.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_8G04250)"
FT                   /note="transcript_id=CADANIAT00008049"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008049"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008049"
FT                   /db_xref="GOA:Q5BDE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE4"
FT                   /protein_id="CBF84855.1"
FT                   /translation="MLRPVIRGARWYQHVARSSSSAASPRSFTRAFTAAAPRLIDYGGP
FT                   NDKIKFYEQDTRRSTKRRRIDPEAEDIAEKEEVARELSQLDHELESLKEDPFGPNSSFI
FT                   QSLPEDERAIALEALRKQEARDGKDEPITFDDVFDEELDNLLKEEFEGLALEEENWMKK
FT                   KDDSLQEVIRQPYEMAFGDSEHSDYIDRFNRALKRFAADKSSEKARQDLWNWYRGCKQI
FT                   IPHFVSAIPEEAMTLLWSSQTSVGQHAARIQVLAEDALLAGRSLPTAHVLSYISSLQQL
FT                   GKTREALDQWEMHQDGLSQQKEDLEAYWKLGVQLFTAEGNPQRAQDIALAFMKNDNFQH
FT                   ARILIPIIIAWGRQSGKEADSKLWALYLQLKAMLRHKMTMDDYDQISIGLLKAGKLDLA
FT                   IAVFKDMMVTGKDSANDSTALYTAALGLAGNLQASAVSEQDVNKVSLSTLTVLPRRFEN
FT                   RFFYASWLKKLIGMGEVDSAALVVELMYERGVRPDPKHLNGLIAGWLREGSAPAREKAE
FT                   ELGWSMIKQRIDRVSKAEAKDSEQPETGRTNARIPKFMQRPMPAATIETFSILLLHYTR
FT                   RGDQEAVEHLVKNLTLSRIQPNSYFMNHLLYAELRKQDIGALWNKFQVLSSSVQPDLET
FT                   YACLWDCGKLQYDRSRTAYFAEFPTARALYSNMMTWFSYLSTRAQTTAREDFSKDLYDQ
FT                   IIRCFCLSKDLAGTLVALCSLHSTFGFHPDETTARLIILQVARLAAVPSDTPKRRLRRI
FT                   SSTPHSKANIAQVQQLVEILSDRKSATLESRGLTISSLDPHEKEMHQLEIMTDLLRIVM
FT                   SRADTSPNQTPDPNRVEEQLCTVAEEMGVPGIYLGPRLDDENAGLVSMR"
     MLRPVIRGAR WYQHVARSSS SAASPRSFTR AFTAAAPRLI DYGGPNDKIK FYEQDTRRST        60
     KRRRIDPEAE DIAEKEEVAR ELSQLDHELE SLKEDPFGPN SSFIQSLPED ERAIALEALR       120
     KQEARDGKDE PITFDDVFDE ELDNLLKEEF EGLALEEENW MKKKDDSLQE VIRQPYEMAF       180
     GDSEHSDYID RFNRALKRFA ADKSSEKARQ DLWNWYRGCK QIIPHFVSAI PEEAMTLLWS       240
     SQTSVGQHAA RIQVLAEDAL LAGRSLPTAH VLSYISSLQQ LGKTREALDQ WEMHQDGLSQ       300
     QKEDLEAYWK LGVQLFTAEG NPQRAQDIAL AFMKNDNFQH ARILIPIIIA WGRQSGKEAD       360
     SKLWALYLQL KAMLRHKMTM DDYDQISIGL LKAGKLDLAI AVFKDMMVTG KDSANDSTAL       420
     YTAALGLAGN LQASAVSEQD VNKVSLSTLT VLPRRFENRF FYASWLKKLI GMGEVDSAAL       480
     VVELMYERGV RPDPKHLNGL IAGWLREGSA PAREKAEELG WSMIKQRIDR VSKAEAKDSE       540
     QPETGRTNAR IPKFMQRPMP AATIETFSIL LLHYTRRGDQ EAVEHLVKNL TLSRIQPNSY       600
     FMNHLLYAEL RKQDIGALWN KFQVLSSSVQ PDLETYACLW DCGKLQYDRS RTAYFAEFPT       660
     ARALYSNMMT WFSYLSTRAQ TTAREDFSKD LYDQIIRCFC LSKDLAGTLV ALCSLHSTFG       720
     FHPDETTARL IILQVARLAA VPSDTPKRRL RRISSTPHSK ANIAQVQQLV EILSDRKSAT       780
     LESRGLTISS LDPHEKEMHQ LEIMTDLLRI VMSRADTSPN QTPDPNRVEE QLCTVAEEMG       840
     VPGIYLGPRL DDENAGLVSM R                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page