(data stored in ACNUC16935 zone)

EMBL: BN001307.PE264

BN001307.PE264       Location/Qualifiers
FT   CDS             726129..729671
FT                   /locus_tag="ANIA_01437"
FT                   /old_locus_tag="AN1437.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04300)"
FT                   /note="transcript_id=CADANIAT00008050"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008050"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008050"
FT                   /db_xref="GOA:Q5BDE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE3"
FT                   /protein_id="CBF84857.1"
FT                   /translation="MSAVSPQFVQSDSNDRNLDPELSNPFLTENDPEEAEFQKFTIRLT
FT                   PVDDRGSAWTGSTSSQDHSINNTSTTGNHEGYGTTYSEFLSPVDEWASDISGHTSPADL
FT                   MIPGVWPVIATSPQNVTASSPTQSGPSPSSPPASINPSQLLTPVLTNHPSPASDTRSVG
FT                   SPRIPRAQQPPVPRLKTTLLDDNLGPGPVSESVTTISPIVKVESYSRGDSPVRDSFSTN
FT                   RRPSQSSIHLSPGGASNASGEDATIEDDRHSVSRSADGAWVPNVLTGQAGLAPDAREDV
FT                   YVPSPNELDSQRKLAERNADIYTWSEAVSEAHSEAGDDYLCFQRGRTDYHGTRRRAKST
FT                   GDPSLDYFSLKFTPDRSEIRGPGLVLHETSDYSDDETESSAPVSVKEERLVQEAFEMTP
FT                   PEPQSAETGEPQAHQFLGSPPWRDIELDRSPQTTRMQPVSSTQAMVEYQRRARETDAIS
FT                   RVATWGTRDLDANSIRSFQMMSLNENGKEKKHERRNSFLKYLPQKKGNLLKRQRQKTDL
FT                   STMQPVHEGEAQDTESKAAPQRKDSFPHRLSLPFTPKTTNYSISGAVMATTRQMAAIGG
FT                   KDSLSVVSPSTTTTTTTKPWNTLKVRGRSRSEVPRAPGLFELMTTHGGPPVPNISYTSE
FT                   PVENKEAKHARPQHDAAEEDDDDDSEEKLIMEFPIPKELPIPTLEGFKTQILRLNPRIE
FT                   PALIDRFAHEQVRRYKRLIEIKQTHARDVNHRKCKAGKFCFALGGTAKLLPPRLSAQDG
FT                   DSHTQFQIPRPGEEEESSEDLGETTMLAHFPQGVPHPPPQVKLLPAEFECMVCYHVKKF
FT                   QKPSDWTKHIYEDVQPFTCTFPDCTDPKSFKRKADWVRHESERHRQLEWWECSLADCRH
FT                   KCYRKDNFVQHLVREHKMPEPKVKKPRNRELSDGASNDPTSLEVQEEINREREINGLWK
FT                   LVESCHFETARNPREEPCRFCGNVCTNWKKLTVHLAKHMEQLAIPILGLVKERDFPYTV
FT                   NIGSSGNPDNFSGQVPIAQKDSDFDPRLDTGVTEGPGTADNFTQAPYSNSHPGSSEPIM
FT                   LPFNTGASYLPNASMPLDSTAPNPAARFEGVTPYTAHGGGVAGLAGDQTRLMAMHQHQN
FT                   SVTYPPFNARPRLTVPNQDMRVLPEYNSFSMSPTEMQYDPQTTAYVSSGAENHYPYQGP
FT                   IASAMPYDSGYQGQ"
     MSAVSPQFVQ SDSNDRNLDP ELSNPFLTEN DPEEAEFQKF TIRLTPVDDR GSAWTGSTSS        60
     QDHSINNTST TGNHEGYGTT YSEFLSPVDE WASDISGHTS PADLMIPGVW PVIATSPQNV       120
     TASSPTQSGP SPSSPPASIN PSQLLTPVLT NHPSPASDTR SVGSPRIPRA QQPPVPRLKT       180
     TLLDDNLGPG PVSESVTTIS PIVKVESYSR GDSPVRDSFS TNRRPSQSSI HLSPGGASNA       240
     SGEDATIEDD RHSVSRSADG AWVPNVLTGQ AGLAPDARED VYVPSPNELD SQRKLAERNA       300
     DIYTWSEAVS EAHSEAGDDY LCFQRGRTDY HGTRRRAKST GDPSLDYFSL KFTPDRSEIR       360
     GPGLVLHETS DYSDDETESS APVSVKEERL VQEAFEMTPP EPQSAETGEP QAHQFLGSPP       420
     WRDIELDRSP QTTRMQPVSS TQAMVEYQRR ARETDAISRV ATWGTRDLDA NSIRSFQMMS       480
     LNENGKEKKH ERRNSFLKYL PQKKGNLLKR QRQKTDLSTM QPVHEGEAQD TESKAAPQRK       540
     DSFPHRLSLP FTPKTTNYSI SGAVMATTRQ MAAIGGKDSL SVVSPSTTTT TTTKPWNTLK       600
     VRGRSRSEVP RAPGLFELMT THGGPPVPNI SYTSEPVENK EAKHARPQHD AAEEDDDDDS       660
     EEKLIMEFPI PKELPIPTLE GFKTQILRLN PRIEPALIDR FAHEQVRRYK RLIEIKQTHA       720
     RDVNHRKCKA GKFCFALGGT AKLLPPRLSA QDGDSHTQFQ IPRPGEEEES SEDLGETTML       780
     AHFPQGVPHP PPQVKLLPAE FECMVCYHVK KFQKPSDWTK HIYEDVQPFT CTFPDCTDPK       840
     SFKRKADWVR HESERHRQLE WWECSLADCR HKCYRKDNFV QHLVREHKMP EPKVKKPRNR       900
     ELSDGASNDP TSLEVQEEIN REREINGLWK LVESCHFETA RNPREEPCRF CGNVCTNWKK       960
     LTVHLAKHME QLAIPILGLV KERDFPYTVN IGSSGNPDNF SGQVPIAQKD SDFDPRLDTG      1020
     VTEGPGTADN FTQAPYSNSH PGSSEPIMLP FNTGASYLPN ASMPLDSTAP NPAARFEGVT      1080
     PYTAHGGGVA GLAGDQTRLM AMHQHQNSVT YPPFNARPRL TVPNQDMRVL PEYNSFSMSP      1140
     TEMQYDPQTT AYVSSGAENH YPYQGPIASA MPYDSGYQGQ                            1180
//

If you have problems or comments...

PBIL Back to PBIL home page