(data stored in ACNUC16935 zone)

EMBL: BN001307.PE265

BN001307.PE265       Location/Qualifiers
FT   CDS             join(731420..731781,731892..732101,732157..732763)
FT                   /locus_tag="ANIA_01438"
FT                   /old_locus_tag="AN1438.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04290)"
FT                   /note="transcript_id=CADANIAT00008051"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008051"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008051"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM53"
FT                   /protein_id="CBF84858.1"
FT                   /translation="MVQELGEFDRRCSASHYSEPSETGSQYNGLHSSDSGYSTRSCTTR
FT                   SIATSYAVGSACSPRLTPQEYEHGEKTAPVGAELAHHYEPMDIVGPPESPSIFGHEVIK
FT                   CDYPKCPWTGKCPSDKRRKEGFGTINDLARHKKCVHKKEPERGPKVLYMCFGRNCPRSS
FT                   KKWPRLDNFRQHLARMHNNEDADELLRRSREWYENLKSKDTVSIHTDNMPEQATLSQVR
FT                   PESGIMVQSASNDLQDPLAAIHTAFQAANSSMLSLDPVREHSMLDIDHTRAIELAELKL
FT                   GPALEQNPSQPANPRHDKMDNMISEAAVSVINAMTKMINNHQRRRGHLGEDDITEQDGE
FT                   LSDRNRDILQKILVTASELLSGSPGPGNSNPLEKTSNRSDRASWSQCEFCPE"
     MVQELGEFDR RCSASHYSEP SETGSQYNGL HSSDSGYSTR SCTTRSIATS YAVGSACSPR        60
     LTPQEYEHGE KTAPVGAELA HHYEPMDIVG PPESPSIFGH EVIKCDYPKC PWTGKCPSDK       120
     RRKEGFGTIN DLARHKKCVH KKEPERGPKV LYMCFGRNCP RSSKKWPRLD NFRQHLARMH       180
     NNEDADELLR RSREWYENLK SKDTVSIHTD NMPEQATLSQ VRPESGIMVQ SASNDLQDPL       240
     AAIHTAFQAA NSSMLSLDPV REHSMLDIDH TRAIELAELK LGPALEQNPS QPANPRHDKM       300
     DNMISEAAVS VINAMTKMIN NHQRRRGHLG EDDITEQDGE LSDRNRDILQ KILVTASELL       360
     SGSPGPGNSN PLEKTSNRSD RASWSQCEFC PE                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page