(data stored in ACNUC16935 zone)

EMBL: BN001307.PE266

BN001307.PE266       Location/Qualifiers
FT   CDS             complement(join(733895..733953,734007..734133,
FT                   734197..734334))
FT                   /locus_tag="ANIA_01439"
FT                   /old_locus_tag="AN1439.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008052"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008052"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008052"
FT                   /db_xref="GOA:Q5BDE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE1"
FT                   /protein_id="CBF84860.1"
FT                   /translation="MPPRLNFNCSRALFRRNLTTTRTRLNTGMPPHPPTQQPETSAYKE
FT                   GMSRYKVFASPFAKVFLGAVFTYQVIYWTWVKLEMEEVKVEKNQQLAALETEARELTGT
FT                   GKK"
     MPPRLNFNCS RALFRRNLTT TRTRLNTGMP PHPPTQQPET SAYKEGMSRY KVFASPFAKV        60
     FLGAVFTYQV IYWTWVKLEM EEVKVEKNQQ LAALETEARE LTGTGKK                     107
//

If you have problems or comments...

PBIL Back to PBIL home page