(data stored in ACNUC16935 zone)

EMBL: BN001307.PE268

BN001307.PE268       Location/Qualifiers
FT   CDS             join(740982..741245,741398..741889)
FT                   /locus_tag="ANIA_10204"
FT                   /old_locus_tag="AN10204.4"
FT                   /product="nucleoside-diphosphate-sugar epimerase family
FT                   protein (AFU_orthologue; AFUA_6G11740)"
FT                   /note="transcript_id=CADANIAT00008054"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008054"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008054"
FT                   /db_xref="GOA:C8VM56"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM56"
FT                   /protein_id="CBF84864.1"
FT                   /translation="MFYTIPEYSRRSWLFMTAVTNQLIPLPRNASFEILAATRNSQSPS
FT                   AQSLSRLSSNIKLVEVNLDDPAAIFHNAHRAEQIPIWGVFSVQTSVDRGGEAKSPNNPT
FT                   RIPHFIHKHNIEHHLIQQAKVNDMQWLILRPTAFYENLVPRFFGIIFATCFKMALKGKP
FT                   LQLVATSGIGYFAAEGFLNPKKYAGRGLSLAGDELTYDQFVEIFEQKTEQTIPSTFRPL
FT                   CSLLLTLIKDMGYMFKWFMTKGTGRILLS"
     MFYTIPEYSR RSWLFMTAVT NQLIPLPRNA SFEILAATRN SQSPSAQSLS RLSSNIKLVE        60
     VNLDDPAAIF HNAHRAEQIP IWGVFSVQTS VDRGGEAKSP NNPTRIPHFI HKHNIEHHLI       120
     QQAKVNDMQW LILRPTAFYE NLVPRFFGII FATCFKMALK GKPLQLVATS GIGYFAAEGF       180
     LNPKKYAGRG LSLAGDELTY DQFVEIFEQK TEQTIPSTFR PLCSLLLTLI KDMGYMFKWF       240
     MTKGTGRILL S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page