(data stored in ACNUC16935 zone)

EMBL: BN001307.PE27

BN001307.PE27        Location/Qualifiers
FT   CDS             complement(join(73021..74557,74645..75288))
FT                   /locus_tag="ANIA_09035"
FT                   /old_locus_tag="AN9035.4"
FT                   /product="Putative alpha-galactosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARP5]"
FT                   /note="transcript_id=CADANIAT00007818"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007818"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007818"
FT                   /db_xref="GOA:Q5ARP5"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARP5"
FT                   /protein_id="CBF84419.1"
FT                   /translation="MTNSKARYVLEPVQVTGTTFALNGTTLSYQFHVDEPSADLRSDHF
FT                   GGSISGPIPVDPEPIVDGWTGMPDRVRREFPDQGRGDFRVPAFRIRQAEGHTVSAFRYR
FT                   EHEIVPGKEVSASGLPGVFGDAHDATTLIVRLVDPYSDLAAELKYTVFPKYDTVVRSAS
FT                   ITNKSNSDVTIESLASLSVDFPFDELEMIGLRGDWAREAHRLRRKVDYGVQSFGSTTGF
FT                   SSHLHNPFVALVHPSTTESQGEAWGFSLIYSGSFTINVEKSSQGLTRVSIGPSQLSWTL
FT                   KPGETFDSPECVAVYSSTGIGGMSRSLHGLYRKHLMKSKFATEDRPVLLNSWEGLYFHI
FT                   DQDRMYRLAQEAAALGVKLLVMDDGWFGDEHPRTSDDAGLGDWIPNPARFPDGLTPLVN
FT                   RITALKVANSQRNMRFGIWVEPEMVNPRSTLYQQHPDWVLHAGNYPRTEQRNQLVLNMS
FT                   LPEVQEFIISAMSEILNAADITYVKWDHNRGLAETPSPCANHAYMLGAYRVFDVLTTRF
FT                   PNVIWEGCASGGGRFDPGILQYFPQVWTSDDSDAVERIFIQFGTSLAYPASAMGGHISS
FT                   VPNHQTGRTTPLTFRAHVAMMCGSFGLELDPAHLTDSERRDIPGLIALAEKISPIVVKG
FT                   DLWRLALPEDSNWPAALFLSENRTQGVLFFFQLAPMVNHSLPRVRLQGLEDGALYRVDG
FT                   EGPYSGSMLMNLGLQYSFRGDYGSRLAFIERE"
     MTNSKARYVL EPVQVTGTTF ALNGTTLSYQ FHVDEPSADL RSDHFGGSIS GPIPVDPEPI        60
     VDGWTGMPDR VRREFPDQGR GDFRVPAFRI RQAEGHTVSA FRYREHEIVP GKEVSASGLP       120
     GVFGDAHDAT TLIVRLVDPY SDLAAELKYT VFPKYDTVVR SASITNKSNS DVTIESLASL       180
     SVDFPFDELE MIGLRGDWAR EAHRLRRKVD YGVQSFGSTT GFSSHLHNPF VALVHPSTTE       240
     SQGEAWGFSL IYSGSFTINV EKSSQGLTRV SIGPSQLSWT LKPGETFDSP ECVAVYSSTG       300
     IGGMSRSLHG LYRKHLMKSK FATEDRPVLL NSWEGLYFHI DQDRMYRLAQ EAAALGVKLL       360
     VMDDGWFGDE HPRTSDDAGL GDWIPNPARF PDGLTPLVNR ITALKVANSQ RNMRFGIWVE       420
     PEMVNPRSTL YQQHPDWVLH AGNYPRTEQR NQLVLNMSLP EVQEFIISAM SEILNAADIT       480
     YVKWDHNRGL AETPSPCANH AYMLGAYRVF DVLTTRFPNV IWEGCASGGG RFDPGILQYF       540
     PQVWTSDDSD AVERIFIQFG TSLAYPASAM GGHISSVPNH QTGRTTPLTF RAHVAMMCGS       600
     FGLELDPAHL TDSERRDIPG LIALAEKISP IVVKGDLWRL ALPEDSNWPA ALFLSENRTQ       660
     GVLFFFQLAP MVNHSLPRVR LQGLEDGALY RVDGEGPYSG SMLMNLGLQY SFRGDYGSRL       720
     AFIERE                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page