(data stored in ACNUC16935 zone)

EMBL: BN001307.PE270

BN001307.PE270       Location/Qualifiers
FT   CDS             join(745221..745320,745386..745690,745763..746176)
FT                   /locus_tag="ANIA_01442"
FT                   /old_locus_tag="AN1442.4"
FT                   /product="translocation protein (Sec66), putative
FT                   (AFU_orthologue; AFUA_8G04260)"
FT                   /note="transcript_id=CADANIAT00008055"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008055"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008055"
FT                   /db_xref="GOA:Q5BDD8"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD8"
FT                   /protein_id="CBF84867.1"
FT                   /translation="MVDWVTLIVPFAYLSVLIGSLATFSSLYRKRKARKATSLEPWFPS
FT                   HLQRDIYFSLLHLDPPASATEKKVAVPESVLKAALLRRAQEDIRRVMTLRSQKQALSVL
FT                   LQRGSVGDDLWQRFLRAEKEMEDEVRDVVTEANAYAPNWGQVIFQSANEMVNNEIVRER
FT                   LDKHQKKLDEEKAWWEKKKASIQEGFMKELDAEKPGTVTTAAAATAAPEVAEGTQVAVG
FT                   SKASASAAAPPAPTVTESDDDAVLVEADDQAGSAGQKSPGGGKKKKKGKK"
     MVDWVTLIVP FAYLSVLIGS LATFSSLYRK RKARKATSLE PWFPSHLQRD IYFSLLHLDP        60
     PASATEKKVA VPESVLKAAL LRRAQEDIRR VMTLRSQKQA LSVLLQRGSV GDDLWQRFLR       120
     AEKEMEDEVR DVVTEANAYA PNWGQVIFQS ANEMVNNEIV RERLDKHQKK LDEEKAWWEK       180
     KKASIQEGFM KELDAEKPGT VTTAAAATAA PEVAEGTQVA VGSKASASAA APPAPTVTES       240
     DDDAVLVEAD DQAGSAGQKS PGGGKKKKKG KK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page