(data stored in ACNUC16935 zone)

EMBL: BN001307.PE271

BN001307.PE271       Location/Qualifiers
FT   CDS             complement(join(746827..747790,748016..750981))
FT                   /locus_tag="ANIA_01443"
FT                   /old_locus_tag="AN1443.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008056"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008056"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008056"
FT                   /db_xref="GOA:Q5BDD7"
FT                   /db_xref="InterPro:IPR038799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD7"
FT                   /protein_id="CBF84868.1"
FT                   /translation="MAKSGKKNKKGVKKGKSQEDAPAPQPEVPSTEPEQQQPAADTPQP
FT                   EVPSTGPEQQQLAADTPQPEEAPELPTASTTGEEPNPLAKSEVTTQVVPEIVPDLKPVL
FT                   ESAPEREPEPEQTQNIEQSQTPSDPDIPSQTPLEDNDFTEITKHDTSSNQPPGMIDTQI
FT                   EHIQEPSHDDLGVWEQLDTAEAEKNHDDTPIEQSNSVDQSEQSPITAPQSPTFTFAPET
FT                   STTEPTETWSAWEENDLTKASPAEEETATPKNDDHNSHVFTNPSGEIASTEPASESAQT
FT                   SDLAPAPASQPEVELPLESELAKEAEPIQKPEPVKEPEPAAEPETFFSEPVEPIEVPEP
FT                   VQKPETATSPEPVREPEPVQEPEVAITPEPVEEPEPVQVPEAVTAPESAIEPEPLATVE
FT                   PAMGAEHTMEPAQEVTPPASKPQSPAPATASPSYKSASPMQRAVSPAAISVADTVDAPH
FT                   AFPPPPAAPTPPPASPKTQDVPPLKDASYPTPRAAPPTPPSASPQYNSSYPTDQAYSPR
FT                   QKSSPSHNTRKPSSPIPKISSPLAHAYTSPVMSPHTTSVPPMPPSFPPSVSHSYATAYQ
FT                   SPAMSTAGYFPPQYGYYQPTSHPHHTPRGPMAPNGPYPGLRDPGYPNEHDRSGRGGPMV
FT                   PPDQEDARELLDRIQDAIPDINRLLGSYKHTKTKLQSREAEFKQMESQHKQALMHKDFF
FT                   IEALQNQLRKTANESAEEATKLKNMINELRMELGNMEEKRKDMEEKLADSEASISSLEE
FT                   KKTGLEEQIKKLNEQIEEERVAHSQELDRQRAEMEAEKEEALKTQKQELTELFEEIKAE
FT                   DEKAAAEALAAREAELLEQQEAMKIEYEQQKQQMQNSHDTLQAEFDTKLAELATTQGDL
FT                   EKKHQELEDTRHAHVEQVESLENQHQEKITEMERAWTEEKTGLETQLSEKSEELANSER
FT                   ENKRLEEDLLSKEKQLQLSVDNMRLTINNLDNDCDRLRKTLHSLGEATDLKNTKGDTFF
FT                   LDCFGQLQRLIVTLSKEHFSYLPIDPPQEVLSKLPPELPSFLDNTPASRELRSAYVQHV
FT                   VSKILTYRIFHPFLFTLGRRYDKADILFQMLSMDIRRKSVRREAFWRQQTLKAAYTTSD
FT                   AKESINVVAAVIVDEISNSLKHFADPRRMDGLLTSIRKIVKLAAETWRHARVERELIIA
FT                   ALPAPEDGSVPGEDWEEYGVPKENSSGRTSPKTADFARHVVLRPFPRIIREAAHEDFLG
FT                   DEGKASPCTYSRGSVLYSDSPIILARLQELAGKTTDAPVRREDSPPATGRLSRASTYYE
FT                   PPSPRIPYAQDTLIEGATGPNFGTA"
     MAKSGKKNKK GVKKGKSQED APAPQPEVPS TEPEQQQPAA DTPQPEVPST GPEQQQLAAD        60
     TPQPEEAPEL PTASTTGEEP NPLAKSEVTT QVVPEIVPDL KPVLESAPER EPEPEQTQNI       120
     EQSQTPSDPD IPSQTPLEDN DFTEITKHDT SSNQPPGMID TQIEHIQEPS HDDLGVWEQL       180
     DTAEAEKNHD DTPIEQSNSV DQSEQSPITA PQSPTFTFAP ETSTTEPTET WSAWEENDLT       240
     KASPAEEETA TPKNDDHNSH VFTNPSGEIA STEPASESAQ TSDLAPAPAS QPEVELPLES       300
     ELAKEAEPIQ KPEPVKEPEP AAEPETFFSE PVEPIEVPEP VQKPETATSP EPVREPEPVQ       360
     EPEVAITPEP VEEPEPVQVP EAVTAPESAI EPEPLATVEP AMGAEHTMEP AQEVTPPASK       420
     PQSPAPATAS PSYKSASPMQ RAVSPAAISV ADTVDAPHAF PPPPAAPTPP PASPKTQDVP       480
     PLKDASYPTP RAAPPTPPSA SPQYNSSYPT DQAYSPRQKS SPSHNTRKPS SPIPKISSPL       540
     AHAYTSPVMS PHTTSVPPMP PSFPPSVSHS YATAYQSPAM STAGYFPPQY GYYQPTSHPH       600
     HTPRGPMAPN GPYPGLRDPG YPNEHDRSGR GGPMVPPDQE DARELLDRIQ DAIPDINRLL       660
     GSYKHTKTKL QSREAEFKQM ESQHKQALMH KDFFIEALQN QLRKTANESA EEATKLKNMI       720
     NELRMELGNM EEKRKDMEEK LADSEASISS LEEKKTGLEE QIKKLNEQIE EERVAHSQEL       780
     DRQRAEMEAE KEEALKTQKQ ELTELFEEIK AEDEKAAAEA LAAREAELLE QQEAMKIEYE       840
     QQKQQMQNSH DTLQAEFDTK LAELATTQGD LEKKHQELED TRHAHVEQVE SLENQHQEKI       900
     TEMERAWTEE KTGLETQLSE KSEELANSER ENKRLEEDLL SKEKQLQLSV DNMRLTINNL       960
     DNDCDRLRKT LHSLGEATDL KNTKGDTFFL DCFGQLQRLI VTLSKEHFSY LPIDPPQEVL      1020
     SKLPPELPSF LDNTPASREL RSAYVQHVVS KILTYRIFHP FLFTLGRRYD KADILFQMLS      1080
     MDIRRKSVRR EAFWRQQTLK AAYTTSDAKE SINVVAAVIV DEISNSLKHF ADPRRMDGLL      1140
     TSIRKIVKLA AETWRHARVE RELIIAALPA PEDGSVPGED WEEYGVPKEN SSGRTSPKTA      1200
     DFARHVVLRP FPRIIREAAH EDFLGDEGKA SPCTYSRGSV LYSDSPIILA RLQELAGKTT      1260
     DAPVRREDSP PATGRLSRAS TYYEPPSPRI PYAQDTLIEG ATGPNFGTA                  1309
//

If you have problems or comments...

PBIL Back to PBIL home page