(data stored in ACNUC16935 zone)

EMBL: BN001307.PE272

BN001307.PE272       Location/Qualifiers
FT   CDS             join(752372..752488,752566..752810,752869..753025)
FT                   /locus_tag="ANIA_01444"
FT                   /old_locus_tag="AN1444.4"
FT                   /product="NADH-ubiquinone oxidoreductase 178 kDa subunit,
FT                   putative (AFU_orthologue; AFUA_8G04320)"
FT                   /note="transcript_id=CADANIAT00008057"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008057"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008057"
FT                   /db_xref="GOA:Q5BDD6"
FT                   /db_xref="InterPro:IPR034444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD6"
FT                   /protein_id="CBF84870.1"
FT                   /translation="MILARRSVASARLLLRNQQPRRFDSHAAHHAEPVNESFGRSFYVA
FT                   VGTFASCFALYQFTKPGKVADSQSALTRLIEKWTPSEKVFEERNALHTAAAERAARDRH
FT                   LFLSQAPSEVYELKSPESSFHPGHPYNVIAGSKADLSEVIAHYERKNQKIEEARVARMQ
FT                   DGKVVSIYD"
     MILARRSVAS ARLLLRNQQP RRFDSHAAHH AEPVNESFGR SFYVAVGTFA SCFALYQFTK        60
     PGKVADSQSA LTRLIEKWTP SEKVFEERNA LHTAAAERAA RDRHLFLSQA PSEVYELKSP       120
     ESSFHPGHPY NVIAGSKADL SEVIAHYERK NQKIEEARVA RMQDGKVVSI YD               172
//

If you have problems or comments...

PBIL Back to PBIL home page