(data stored in ACNUC16935 zone)

EMBL: BN001307.PE273

BN001307.PE273       Location/Qualifiers
FT   CDS             complement(join(753251..753931,754022..754363,
FT                   754464..754625))
FT                   /locus_tag="ANIA_01445"
FT                   /old_locus_tag="AN1445.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008058"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008058"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008058"
FT                   /db_xref="GOA:Q5BDD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD5"
FT                   /protein_id="CBF84871.1"
FT                   /translation="MASKFSFGFSGDDIDIDLDENELDDATESGHQDAGTASTLPELVK
FT                   AQKHEIDEWLSMLPSQISYNTCTISPFQEKGLGQGASASTDIGANTVTVARRDVFDIRA
FT                   QLMVEDSAEEQNGELIAGLEKGDITPNFYEGGFKTWECSIDLAGLVVGEGVGLEDEGED
FT                   RHVIELGSGTAVPSLAVFAQLLARTETDGTTSKPAEKKKQTHFTFADYNSAVLRLVTVP
FT                   NLLLTWNHFTTHRKSAQPSDGQSEDKAESQEEMLDITPDLVERFQSDLAHRGITVSFIS
FT                   GAWSPSFVELVFSSPELAGYRTLILASETIYSPASLAAFSETLLMLLRRSSQSNHASRA
FT                   LVAAKKVYFGVGGGVDEFLTILRSVADGNVDVGERMDVKSAGVGRTILEVSAST"
     MASKFSFGFS GDDIDIDLDE NELDDATESG HQDAGTASTL PELVKAQKHE IDEWLSMLPS        60
     QISYNTCTIS PFQEKGLGQG ASASTDIGAN TVTVARRDVF DIRAQLMVED SAEEQNGELI       120
     AGLEKGDITP NFYEGGFKTW ECSIDLAGLV VGEGVGLEDE GEDRHVIELG SGTAVPSLAV       180
     FAQLLARTET DGTTSKPAEK KKQTHFTFAD YNSAVLRLVT VPNLLLTWNH FTTHRKSAQP       240
     SDGQSEDKAE SQEEMLDITP DLVERFQSDL AHRGITVSFI SGAWSPSFVE LVFSSPELAG       300
     YRTLILASET IYSPASLAAF SETLLMLLRR SSQSNHASRA LVAAKKVYFG VGGGVDEFLT       360
     ILRSVADGNV DVGERMDVKS AGVGRTILEV SAST                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page