(data stored in ACNUC16935 zone)

EMBL: BN001307.PE275

BN001307.PE275       Location/Qualifiers
FT   CDS             complement(join(757013..757064,757194..757234,
FT                   757459..757633,757680..757743,757796..757882,
FT                   757947..758043,758117..758215,758271..758282))
FT                   /locus_tag="ANIA_01447"
FT                   /old_locus_tag="AN1447.4"
FT                   /product="DNA-directed RNA polymerase III subunit 22.9 kDa,
FT                   putative (AFU_orthologue; AFUA_8G04350)"
FT                   /note="transcript_id=CADANIAT00008060"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008060"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008060"
FT                   /db_xref="GOA:Q5BDD3"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD3"
FT                   /protein_id="CBF84875.1"
FT                   /translation="MFILTTISDLIQISPEDFSKYSSVAIEDNINEKYANKVIQKIGLC
FT                   IGFYDLLESSDGLIGHGTGLVNVNVKFRLIVFRPFRGEIVLGKISSATENGIKIGVEFF
FT                   NDILVPPDLLLDGARFDYQDQVWIWENEEGTFYFDVGEVVRFRVEMEEWHDQIPNAPDL
FT                   GDGAPIDRKPPYSIIRGRTLSSPSGSYIRAILMYGLGYRRNEIGQ"
     MFILTTISDL IQISPEDFSK YSSVAIEDNI NEKYANKVIQ KIGLCIGFYD LLESSDGLIG        60
     HGTGLVNVNV KFRLIVFRPF RGEIVLGKIS SATENGIKIG VEFFNDILVP PDLLLDGARF       120
     DYQDQVWIWE NEEGTFYFDV GEVVRFRVEM EEWHDQIPNA PDLGDGAPID RKPPYSIIRG       180
     RTLSSPSGSY IRAILMYGLG YRRNEIGQ                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page