(data stored in ACNUC16935 zone)

EMBL: BN001307.PE276

BN001307.PE276       Location/Qualifiers
FT   CDS             join(758721..760439,760507..760749)
FT                   /locus_tag="ANIA_01448"
FT                   /old_locus_tag="AN1448.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G04360)"
FT                   /note="transcript_id=CADANIAT00008061"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008061"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008061"
FT                   /db_xref="GOA:Q5BDD2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD2"
FT                   /protein_id="CBF84877.1"
FT                   /translation="MNPQGFSFPPPPPPPPTQHPPQQQYAHNNAFTPYGQNHHGQRGGR
FT                   GGGQFRGRGRGYGNRGRGGHFMSSDANHSGGYAAAHAGYAPMTHSGYPAQHMPNQQTGI
FT                   PTPHYTQSSSQAFSNAVTGSTFASTSHYPQPAVNGTAYQHQSSYGTTYATPTQQSPPYT
FT                   QTHPAHQNATPSVQPTMMGPPIRWGFEGTGHSGSFPGLQRPSQRGPRQNNTYNNQSSPG
FT                   KHANKRDHTSAFGKPQSTAPRFPAPPPVPSFGNPLPLKPPTPVDSQRKPKKKKRKHNQL
FT                   GLTPKTEEHESSEEEDDADEETRLASGGPGTGVALQITYKGRTSNLQTSADIAAWIAER
FT                   KKRFPTQAKIEEKKKAMEEAKKAKKAREEAQRQQREARKSAATRAKDQEKKEQTRVALD
FT                   PADAAAKAKMKAEKLRRKLLKEEKRIAQAEADAERARKMDGVQEDSVPTEREADQPEKK
FT                   DSAANEQAVGDLASDASDDSDWTSSSGSDLSSSDSDESSDDDDDDSAPEQATSRREGPE
FT                   RVAPPARDEKKRICRHFARNGRCPRGKTCKFAHEKPDRGTKAQPVENKGRKGLLEALLD
FT                   RQKEDENRKLMETIIWLGENGLLDEPAAQQDVFSTDPTRQTDESTGPLDASDIQLGNVS
FT                   TSGSVGEQCHPSEGTARV"
     MNPQGFSFPP PPPPPPTQHP PQQQYAHNNA FTPYGQNHHG QRGGRGGGQF RGRGRGYGNR        60
     GRGGHFMSSD ANHSGGYAAA HAGYAPMTHS GYPAQHMPNQ QTGIPTPHYT QSSSQAFSNA       120
     VTGSTFASTS HYPQPAVNGT AYQHQSSYGT TYATPTQQSP PYTQTHPAHQ NATPSVQPTM       180
     MGPPIRWGFE GTGHSGSFPG LQRPSQRGPR QNNTYNNQSS PGKHANKRDH TSAFGKPQST       240
     APRFPAPPPV PSFGNPLPLK PPTPVDSQRK PKKKKRKHNQ LGLTPKTEEH ESSEEEDDAD       300
     EETRLASGGP GTGVALQITY KGRTSNLQTS ADIAAWIAER KKRFPTQAKI EEKKKAMEEA       360
     KKAKKAREEA QRQQREARKS AATRAKDQEK KEQTRVALDP ADAAAKAKMK AEKLRRKLLK       420
     EEKRIAQAEA DAERARKMDG VQEDSVPTER EADQPEKKDS AANEQAVGDL ASDASDDSDW       480
     TSSSGSDLSS SDSDESSDDD DDDSAPEQAT SRREGPERVA PPARDEKKRI CRHFARNGRC       540
     PRGKTCKFAH EKPDRGTKAQ PVENKGRKGL LEALLDRQKE DENRKLMETI IWLGENGLLD       600
     EPAAQQDVFS TDPTRQTDES TGPLDASDIQ LGNVSTSGSV GEQCHPSEGT ARV              653
//

If you have problems or comments...

PBIL Back to PBIL home page