(data stored in ACNUC16935 zone)

EMBL: BN001307.PE277

BN001307.PE277       Location/Qualifiers
FT   CDS             join(762660..762867,762926..763416)
FT                   /locus_tag="ANIA_01449"
FT                   /old_locus_tag="AN1449.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_8G04370)"
FT                   /note="transcript_id=CADANIAT00008062"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008062"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008062"
FT                   /db_xref="GOA:Q5BDD1"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD1"
FT                   /protein_id="CBF84879.1"
FT                   /translation="MRSVFFFALSAVATLVAARENAFNIPKNGYSFTAGEATTLSWEPS
FT                   TEGTVTLKLQHGEVLTSDSGTTIASSIPNSGSFTWSVPSDIEDYSDYTIEIISDSDPDA
FT                   TNYLPRFSVEGAEEVTTTSSTTSTETTTTTTTTETSSTTTETTLTTTTTTTTESTTSPT
FT                   PTSTTETPSKTPASATSTESSSTSTSSESATDTPTSVPNVNGEDGDNAGMSNRVSGGLL
FT                   VLALGVAALV"
     MRSVFFFALS AVATLVAARE NAFNIPKNGY SFTAGEATTL SWEPSTEGTV TLKLQHGEVL        60
     TSDSGTTIAS SIPNSGSFTW SVPSDIEDYS DYTIEIISDS DPDATNYLPR FSVEGAEEVT       120
     TTSSTTSTET TTTTTTTETS STTTETTLTT TTTTTTESTT SPTPTSTTET PSKTPASATS       180
     TESSSTSTSS ESATDTPTSV PNVNGEDGDN AGMSNRVSGG LLVLALGVAA LV               232
//

If you have problems or comments...

PBIL Back to PBIL home page