(data stored in ACNUC16935 zone)

EMBL: BN001307.PE278

BN001307.PE278       Location/Qualifiers
FT   CDS             complement(join(764818..765612,765698..765835))
FT                   /locus_tag="ANIA_01450"
FT                   /old_locus_tag="AN1450.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008063"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008063"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008063"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD0"
FT                   /protein_id="CBF84880.1"
FT                   /translation="MAKLDQDKTCHLHHAADVTRALIEGLVKMDQVHACRGQVTAANLD
FT                   QTRSWTVRIQDTDSLNEMEVMTPRLILCTGSSPTKTPIPVDAHGIQRLDLDVVLKPSEL
FT                   ASALPQNQPTTVAVVGASHSAVLALLNLYDLARTSHSHLRIKWFTRHPLRYAEYMDGWI
FT                   LRDNTGLKGRAADFARQQLEDSVLPTSEAGRYITKIDCAGGQSKETAQYQRHLPSCTHI
FT                   TQAIGYTRDPLPELSINRSPLSPDDLQWDSSFGGFTDRHGRVIPGLHGAGIAFPERVVD
FT                   PYGNVEHAVGFFKFMKFLKRVTPQWAATA"
     MAKLDQDKTC HLHHAADVTR ALIEGLVKMD QVHACRGQVT AANLDQTRSW TVRIQDTDSL        60
     NEMEVMTPRL ILCTGSSPTK TPIPVDAHGI QRLDLDVVLK PSELASALPQ NQPTTVAVVG       120
     ASHSAVLALL NLYDLARTSH SHLRIKWFTR HPLRYAEYMD GWILRDNTGL KGRAADFARQ       180
     QLEDSVLPTS EAGRYITKID CAGGQSKETA QYQRHLPSCT HITQAIGYTR DPLPELSINR       240
     SPLSPDDLQW DSSFGGFTDR HGRVIPGLHG AGIAFPERVV DPYGNVEHAV GFFKFMKFLK       300
     RVTPQWAATA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page