(data stored in ACNUC16935 zone)

EMBL: BN001307.PE279

BN001307.PE279       Location/Qualifiers
FT   CDS             complement(join(767258..767809,767884..768204))
FT                   /locus_tag="ANIA_01451"
FT                   /old_locus_tag="AN1451.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008064"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008064"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008064"
FT                   /db_xref="GOA:Q5BDC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC9"
FT                   /protein_id="CBF84882.1"
FT                   /translation="MFVRLPFRGRHPMRPAPSRSNEPPEGETEYQQLENQFYPSISDAL
FT                   RVRHLLLWKVQPEGLPAEVVDMIVDAAEYWPSTKVKLDKARRIEKDVDQAVLCTSPLCY
FT                   DEKSLDTPQPKLLPHRTVHPCRKIVFSILSHDQGGYTERHLAGPNNQSPYEHTCTWFDA
FT                   EVIHQAHKPSQKSAINGKMNPTDMRPQHFGPNDPLLLPRNNALQRNRTRIYEAKRHNII
FT                   WHYLDDVAADSQEAEDIARETGRGRDTVGGKQVREMEIGDSIMIWARARFPGWRNYVDD
FT                   VSVQVFWAV"
     MFVRLPFRGR HPMRPAPSRS NEPPEGETEY QQLENQFYPS ISDALRVRHL LLWKVQPEGL        60
     PAEVVDMIVD AAEYWPSTKV KLDKARRIEK DVDQAVLCTS PLCYDEKSLD TPQPKLLPHR       120
     TVHPCRKIVF SILSHDQGGY TERHLAGPNN QSPYEHTCTW FDAEVIHQAH KPSQKSAING       180
     KMNPTDMRPQ HFGPNDPLLL PRNNALQRNR TRIYEAKRHN IIWHYLDDVA ADSQEAEDIA       240
     RETGRGRDTV GGKQVREMEI GDSIMIWARA RFPGWRNYVD DVSVQVFWAV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page