(data stored in ACNUC16935 zone)

EMBL: BN001307.PE280

BN001307.PE280       Location/Qualifiers
FT   CDS             complement(join(768719..770161,770234..770353))
FT                   /locus_tag="ANIA_01452"
FT                   /old_locus_tag="AN1452.4"
FT                   /product="Nucleolar protein 12
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDC8]"
FT                   /note="transcript_id=CADANIAT00008065"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008065"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008065"
FT                   /db_xref="GOA:Q5BDC8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034777"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDC8"
FT                   /protein_id="CBF84884.1"
FT                   /translation="MGKKSKSQKEAPATESAGSLPFLGGNVSVDPSLASLFEQSAGPVK
FT                   VPEVPRLGAAPKTKITDVEKDEEESSSAGNDSASEDQFMEDAPESPDAAEEAVQAVPEP
FT                   PSRKRKRAAGEDLEESYMRRLAKEEQKEQKKRRAERSSSLEEESEDGEKESPQSEDGES
FT                   EDEGADIPKHEALAGAANDDDELSKSNRTVFLGNVSTKAITSKSAKKELMKHLSSFLST
FT                   LPESTGPHKIDSIRFRSTAFASGGKIPKRAAFAKQEIHDDTTPSTNAYAVYSTAQAAKK
FT                   APAALNGTVVLDRHLRVDNVAHPAKVDHKRCVFVGNLDFIDNETGTEEGEKKKKNRPPA
FT                   DVEEGLWRTFNAHTKASQSGPAGRGNVESVRVVRDRSTRVGKGFAYVQFYDQNCVEEAL
FT                   LLNDKRFPPLLPRKLRVVRAKKVAKKSVETTGAPKGSDRTLQGRAGKLLGRSSEARLKA
FT                   AAKKSISQSSLVFEGNRATADGSSRIRVRTKSRGSKAKKDSRSKKRAAAYKAAGGKKAK
FT                   IGK"
     MGKKSKSQKE APATESAGSL PFLGGNVSVD PSLASLFEQS AGPVKVPEVP RLGAAPKTKI        60
     TDVEKDEEES SSAGNDSASE DQFMEDAPES PDAAEEAVQA VPEPPSRKRK RAAGEDLEES       120
     YMRRLAKEEQ KEQKKRRAER SSSLEEESED GEKESPQSED GESEDEGADI PKHEALAGAA       180
     NDDDELSKSN RTVFLGNVST KAITSKSAKK ELMKHLSSFL STLPESTGPH KIDSIRFRST       240
     AFASGGKIPK RAAFAKQEIH DDTTPSTNAY AVYSTAQAAK KAPAALNGTV VLDRHLRVDN       300
     VAHPAKVDHK RCVFVGNLDF IDNETGTEEG EKKKKNRPPA DVEEGLWRTF NAHTKASQSG       360
     PAGRGNVESV RVVRDRSTRV GKGFAYVQFY DQNCVEEALL LNDKRFPPLL PRKLRVVRAK       420
     KVAKKSVETT GAPKGSDRTL QGRAGKLLGR SSEARLKAAA KKSISQSSLV FEGNRATADG       480
     SSRIRVRTKS RGSKAKKDSR SKKRAAAYKA AGGKKAKIGK                             520
//

If you have problems or comments...

PBIL Back to PBIL home page