(data stored in ACNUC16935 zone)

EMBL: BN001307.PE281

BN001307.PE281       Location/Qualifiers
FT   CDS             join(771679..772237,772269..772559,772615..772681,
FT                   772743..773229,773300..773929)
FT                   /locus_tag="ANIA_01453"
FT                   /old_locus_tag="AN1453.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008066"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008066"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008066"
FT                   /db_xref="GOA:Q5BDC7"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC7"
FT                   /protein_id="CBF84886.1"
FT                   /translation="MEVAETREPTTVGAPNGTDETVVNGDQNLFYQDSLLDDGRSSSLS
FT                   EIDDVLENMPSDYESPKPEKIATENDSEAETERIDDSPNNYRTRTNIVLSATSYGPSPS
FT                   KLVHSTTYDDVEEDDVHPADESPSKPRSKNDRTVDSVEEVQEPDDSNLSDSAGKKRKRP
FT                   ESGDELISELDEDDFPPHKRRGSNLALTPEPVEEEVPKVNQEDTLADDIPESDLPSAPT
FT                   KSKRTRKGKRKGRKTRDVDDDAESGAVEMGAEVDDTPADEDAADRPDDADDGEAAAKLE
FT                   EESKRTSAMDSLAVLEREFATLRDKIYDERISKLNRELDMLKGPNPTHPELLRQLDCIK
FT                   GYRDAKIKYEHTLFQYRLKSLLNKSQAERAQAHSTYFQRARDIREHHSSAISKQFYSIQ
FT                   HDRFKTDDVSPQHYIPFPTRRSQQIAHQTAYNQEVSVLAGVAKYVGFPAAPSLSSARPA
FT                   ELDEDLEKMGISFETKAPASHHQSTIPRATIPSMSSNVHPTSAEEAFLEQTPWANPQHP
FT                   YHQHQNLSHRPQNRIMDNSRMSAFATPAGQMRVVDVNAPNGSASTIAENSSANNTPYGL
FT                   EQDNSTAATKPYLDYDARLRSLSSSPTDVRKPHPAMYTSLDHRPPQGIPRNPGYSSPPS
FT                   RLVFGSAPKQDTSPSISSKPVNSLHQPAAMLGSTSQNQMAAR"
     MEVAETREPT TVGAPNGTDE TVVNGDQNLF YQDSLLDDGR SSSLSEIDDV LENMPSDYES        60
     PKPEKIATEN DSEAETERID DSPNNYRTRT NIVLSATSYG PSPSKLVHST TYDDVEEDDV       120
     HPADESPSKP RSKNDRTVDS VEEVQEPDDS NLSDSAGKKR KRPESGDELI SELDEDDFPP       180
     HKRRGSNLAL TPEPVEEEVP KVNQEDTLAD DIPESDLPSA PTKSKRTRKG KRKGRKTRDV       240
     DDDAESGAVE MGAEVDDTPA DEDAADRPDD ADDGEAAAKL EEESKRTSAM DSLAVLEREF       300
     ATLRDKIYDE RISKLNRELD MLKGPNPTHP ELLRQLDCIK GYRDAKIKYE HTLFQYRLKS       360
     LLNKSQAERA QAHSTYFQRA RDIREHHSSA ISKQFYSIQH DRFKTDDVSP QHYIPFPTRR       420
     SQQIAHQTAY NQEVSVLAGV AKYVGFPAAP SLSSARPAEL DEDLEKMGIS FETKAPASHH       480
     QSTIPRATIP SMSSNVHPTS AEEAFLEQTP WANPQHPYHQ HQNLSHRPQN RIMDNSRMSA       540
     FATPAGQMRV VDVNAPNGSA STIAENSSAN NTPYGLEQDN STAATKPYLD YDARLRSLSS       600
     SPTDVRKPHP AMYTSLDHRP PQGIPRNPGY SSPPSRLVFG SAPKQDTSPS ISSKPVNSLH       660
     QPAAMLGSTS QNQMAAR                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page