(data stored in ACNUC16935 zone)

EMBL: BN001307.PE283

BN001307.PE283       Location/Qualifiers
FT   CDS             join(778028..778051,778124..778307,778399..778469)
FT                   /locus_tag="ANIA_11303"
FT                   /old_locus_tag="AN11303.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008068"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008068"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008068"
FT                   /db_xref="GOA:C8VMC2"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC2"
FT                   /protein_id="CBF84890.1"
FT                   /translation="MAASQGVNVLRYSALVAGLVYGFYHQSSITAANRRAEAEREYARQ
FT                   ERLIEQAKAEWKKKTQPQDSKSTGVITDPEDPKFDLEAFLKLKAGEA"
     MAASQGVNVL RYSALVAGLV YGFYHQSSIT AANRRAEAER EYARQERLIE QAKAEWKKKT        60
     QPQDSKSTGV ITDPEDPKFD LEAFLKLKAG EA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page