(data stored in ACNUC16935 zone)

EMBL: BN001307.PE284

BN001307.PE284       Location/Qualifiers
FT   CDS             complement(join(778940..779172,779174..779203,
FT                   779259..779437,779499..779695))
FT                   /locus_tag="ANIA_10208"
FT                   /old_locus_tag="AN10208.4"
FT                   /product="COP9 signalosome complex subunit 8 (CSN complex
FT                   subunit 8) [Source:UniProtKB/Swiss-Prot;Acc:P0C624]"
FT                   /note="transcript_id=CADANIAT00008069"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008069"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008069"
FT                   /db_xref="GOA:P0C624"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C624"
FT                   /protein_id="CBF84891.1"
FT                   /translation="MDLPPLSLDQLSAVITAGPTPTDLYTSLSAYEEQACLLSATDPSE
FT                   KDLLLEFYTAFFFSHLLTDQICEARALTRRIPREISRLDAMQTCSLLLRAVWQSKHTEI
FT                   YKILRELPWPGRSQPLVQRYESYFQEKTLVEMSNSYETIRIAAAATYLGLDPAAVEGDI
FT                   IEKFTACGWKWDSEKQLLHPKPVVTAPPKDDSLQNELSRVMALISNQGS"
     MDLPPLSLDQ LSAVITAGPT PTDLYTSLSA YEEQACLLSA TDPSEKDLLL EFYTAFFFSH        60
     LLTDQICEAR ALTRRIPREI SRLDAMQTCS LLLRAVWQSK HTEIYKILRE LPWPGRSQPL       120
     VQRYESYFQE KTLVEMSNSY ETIRIAAAAT YLGLDPAAVE GDIIEKFTAC GWKWDSEKQL       180
     LHPKPVVTAP PKDDSLQNEL SRVMALISNQ GS                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page