(data stored in ACNUC16935 zone)

EMBL: BN001307.PE285

BN001307.PE285       Location/Qualifiers
FT   CDS             join(780014..780143,780217..780240,780340..780420,
FT                   780522..781115,781165..782290,782347..782617)
FT                   /locus_tag="ANIA_01455"
FT                   /old_locus_tag="AN1455.4"
FT                   /product="hypothetical protein similar to oligosaccharyl
FT                   transferase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008070"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008070"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008070"
FT                   /db_xref="GOA:C8VMC4"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC4"
FT                   /protein_id="CBF84893.1"
FT                   /translation="MAESPVDVLLKGSSGRSARGLLRIIILVTIAAAAVSSRLFSVIRF
FT                   ESIIHEFDPWFNFRATKYLVQNGFYDFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIY
FT                   HILRFLTFPVDIRNICVLLAPGFSGLTAFAMYLLTNEMSSSPSAGLLAAAFMGIAPGYI
FT                   SRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALAALFYGYMVSAWGGYVFITN
FT                   LIPLHVFVLLCMGRYSPRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSALGVFGL
FT                   LQLVAFAEFVRSYIPGKQFQRLLTASIILITGLAFAGLVVLSMSGIIAPWSGRFYSLWD
FT                   TGYAKIHIPIIASVSEHQPTAWPSFFFDLNFLIWLFPAGVYMCFRDLRDEHVFVIIYAV
FT                   LASYFAGVMVRLMLTLTPIVCVAAALVLSYILDTYLKTSPGPVTRGRSNDESSEGLRSA
FT                   RSPEVGITSYFSKAVTTSAAIVYLLLFVAHCTWVTSNAYSSPSVVLASRMPDGSQFIID
FT                   DYREAYYWLRQNTPANAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSR
FT                   EEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVKERDFFTARG
FT                   EYRVDDQATPTMRNSLMYKMSYHNFNKLFPMGQATDRVRGAKLPAESPQLSTLEEAFTS
FT                   ENWIIRIYKVKDLDNLGRDHSNAVAFDRGNKRKKASKRKGPRVLRSE"
     MAESPVDVLL KGSSGRSARG LLRIIILVTI AAAAVSSRLF SVIRFESIIH EFDPWFNFRA        60
     TKYLVQNGFY DFWDWFDDRT WHPLGRVTGG TLYPGLMVTS GVIYHILRFL TFPVDIRNIC       120
     VLLAPGFSGL TAFAMYLLTN EMSSSPSAGL LAAAFMGIAP GYISRSVAGS YDNEAIAIFL       180
     LVFTFFLWIK AVKNGSIMWG ALAALFYGYM VSAWGGYVFI TNLIPLHVFV LLCMGRYSPR       240
     LYISYTTWYA LGTLASMQIP FVGFLPIRNS DHMSALGVFG LLQLVAFAEF VRSYIPGKQF       300
     QRLLTASIIL ITGLAFAGLV VLSMSGIIAP WSGRFYSLWD TGYAKIHIPI IASVSEHQPT       360
     AWPSFFFDLN FLIWLFPAGV YMCFRDLRDE HVFVIIYAVL ASYFAGVMVR LMLTLTPIVC       420
     VAAALVLSYI LDTYLKTSPG PVTRGRSNDE SSEGLRSARS PEVGITSYFS KAVTTSAAIV       480
     YLLLFVAHCT WVTSNAYSSP SVVLASRMPD GSQFIIDDYR EAYYWLRQNT PANAKIMSWW       540
     DYGYQIGGMA DRPTLVDNNT WNNTHIATVG KAMSSREEVS YPILRQHDVD YVLVVFGGLL       600
     GYSGDDINKF LWMVRIAEGI WPDEVKERDF FTARGEYRVD DQATPTMRNS LMYKMSYHNF       660
     NKLFPMGQAT DRVRGAKLPA ESPQLSTLEE AFTSENWIIR IYKVKDLDNL GRDHSNAVAF       720
     DRGNKRKKAS KRKGPRVLRS E                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page