(data stored in ACNUC16935 zone)

EMBL: BN001307.PE287

BN001307.PE287       Location/Qualifiers
FT   CDS             join(784455..784792,784949..785114,785172..785302,
FT                   785369..785572,785621..785969,786019..786839,
FT                   786893..786963,787020..787186)
FT                   /locus_tag="ANIA_01456"
FT                   /old_locus_tag="AN1456.4"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex subunit (Pta1), putative (AFU_orthologue;
FT                   AFUA_8G04420)"
FT                   /note="transcript_id=CADANIAT00008072"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008072"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008072"
FT                   /db_xref="GOA:C8VMC6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC6"
FT                   /protein_id="CBF84897.1"
FT                   /translation="MAQSGDQVTDQIAQLNAARNLVLGDAAFYPQIVNGVLPIIGAHAR
FT                   VELRRWGTEFLAETFASPAFATAPKEQLAINVLQTVRSILELPEGDQLVLQNITQTAAS
FT                   LYPLVFRHIINHPEDKQSWEHIEAIKQDLLRRWDSFPCPVKVCCIKFAQRVVLTQTHGP
FT                   IADPRRPDKNETSLAIVPRNHAILSLPNLEAESSGLLDRILSIFQEDASDPVLVNATLN
FT                   CLAVVIRTRQSIGNKIINAILNFFPARHMRLPVTPAVRIGVKSMERTARAVFINIMKRN
FT                   PSHPLAGKMQQHIERLMQSRIEQVDDTSRKRGLPTEPTDGLDAAKRARLDAETPPIIKV
FT                   PPLPPGRISFAQLFTLTEDSGLSSFDVKQLPADLVVKIAVPLLARVDQSLLGQAVDAIR
FT                   MRYQTVQKQQMTQPQLAAEEDDDDYEPEYQPMDIPASAADETGAVLAAVQEEQTDLVSL
FT                   GPFVLPRPPPLTEEQAAEAGRSAVARVFGMLGSTTLTPNPVKGQGQRLGFSRLAGSTFD
FT                   RDAWVTLLTRLATRAPAGLEGPKQETDSLGRKKPTISDTIRESLYRYILEDFRGRVNIG
FT                   IMWLNEEWYNDRLQMKVASSNRTDEDEEISVPLHYDHWVLRLLDGFLPYLDSRDNKVFI
FT                   RFLSEIPEVTIHIAKRIASLAKDPERVNLCVQSFMYLIMFRPPAREICLDALEEVYQNY
FT                   EESRPSAGKVLSRWRPQRVEQLQAEQTTLVNRTVDNTTITNGSRDPRTAHVAAS"
     MAQSGDQVTD QIAQLNAARN LVLGDAAFYP QIVNGVLPII GAHARVELRR WGTEFLAETF        60
     ASPAFATAPK EQLAINVLQT VRSILELPEG DQLVLQNITQ TAASLYPLVF RHIINHPEDK       120
     QSWEHIEAIK QDLLRRWDSF PCPVKVCCIK FAQRVVLTQT HGPIADPRRP DKNETSLAIV       180
     PRNHAILSLP NLEAESSGLL DRILSIFQED ASDPVLVNAT LNCLAVVIRT RQSIGNKIIN       240
     AILNFFPARH MRLPVTPAVR IGVKSMERTA RAVFINIMKR NPSHPLAGKM QQHIERLMQS       300
     RIEQVDDTSR KRGLPTEPTD GLDAAKRARL DAETPPIIKV PPLPPGRISF AQLFTLTEDS       360
     GLSSFDVKQL PADLVVKIAV PLLARVDQSL LGQAVDAIRM RYQTVQKQQM TQPQLAAEED       420
     DDDYEPEYQP MDIPASAADE TGAVLAAVQE EQTDLVSLGP FVLPRPPPLT EEQAAEAGRS       480
     AVARVFGMLG STTLTPNPVK GQGQRLGFSR LAGSTFDRDA WVTLLTRLAT RAPAGLEGPK       540
     QETDSLGRKK PTISDTIRES LYRYILEDFR GRVNIGIMWL NEEWYNDRLQ MKVASSNRTD       600
     EDEEISVPLH YDHWVLRLLD GFLPYLDSRD NKVFIRFLSE IPEVTIHIAK RIASLAKDPE       660
     RVNLCVQSFM YLIMFRPPAR EICLDALEEV YQNYEESRPS AGKVLSRWRP QRVEQLQAEQ       720
     TTLVNRTVDN TTITNGSRDP RTAHVAAS                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page