(data stored in ACNUC16935 zone)

EMBL: BN001307.PE289

BN001307.PE289       Location/Qualifiers
FT   CDS             791665..792756
FT                   /locus_tag="ANIA_01458"
FT                   /old_locus_tag="AN1458.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008074"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008074"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008074"
FT                   /db_xref="GOA:C8VMC8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC8"
FT                   /protein_id="CBF84901.1"
FT                   /translation="MVEFIPPPDPRDLLPPLLACLPTAFVSQKPPPALLPLLSPILRQR
FT                   VQILSSVSTSSSESWLRLLCWDSEKGERLQSLIDGASFEPHPVSGEIELPDDIPVTYRR
FT                   LDEETLQSRVLIPEYELKVVYLWCPKEESPGWRIAEVLPHQGLGEDDGVWSSTIGDANT
FT                   HAKEKLVEDALKAAERDDHIAPQEEDDDDDDYWARYDATPGRTPSVKNSAPPALTSMLQ
FT                   HHGPSESSYFSQYDDVQPVMDNHDPDEEHPELGPSSLGGDILTELAKRNTDSESHEHMN
FT                   QTNGASLNHPRPESATSSNPEAVSRLEQEAENQSAYEIGVKQHIGSNIKSLFRLAKATG
FT                   ISRADFQSLVKTELDLLNLSDDD"
     MVEFIPPPDP RDLLPPLLAC LPTAFVSQKP PPALLPLLSP ILRQRVQILS SVSTSSSESW        60
     LRLLCWDSEK GERLQSLIDG ASFEPHPVSG EIELPDDIPV TYRRLDEETL QSRVLIPEYE       120
     LKVVYLWCPK EESPGWRIAE VLPHQGLGED DGVWSSTIGD ANTHAKEKLV EDALKAAERD       180
     DHIAPQEEDD DDDDYWARYD ATPGRTPSVK NSAPPALTSM LQHHGPSESS YFSQYDDVQP       240
     VMDNHDPDEE HPELGPSSLG GDILTELAKR NTDSESHEHM NQTNGASLNH PRPESATSSN       300
     PEAVSRLEQE AENQSAYEIG VKQHIGSNIK SLFRLAKATG ISRADFQSLV KTELDLLNLS       360
     DDD                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page