(data stored in ACNUC16935 zone)

EMBL: BN001307.PE29

BN001307.PE29        Location/Qualifiers
FT   CDS             join(80729..80922,80986..81404,81461..81601,81655..81869,
FT                   81935..82132,82186..82329,82497..82562)
FT                   /locus_tag="ANIA_09033"
FT                   /old_locus_tag="AN9033.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007820"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007820"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007820"
FT                   /db_xref="GOA:Q5ARP7"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP7"
FT                   /protein_id="CBF84423.1"
FT                   /translation="MPFHADIPQFQPTNDDIERTQAEKKHKETPTMAVDEQKAESVPYR
FT                   QDVFGDEEHAEVKYKVLKWWQCGLLMVAETISLGILSIPAAIAGLGLVPAIVILLVMGL
FT                   IASYTGYVIGQFKWRYPHVVSMADAGEVLMGRFGREVLFGGQMLFLIFLMASHILTFTV
FT                   AMNRLTNHGTCSLVFGVIGLLVSLVFSLPRTMKNMSWLSLASFISIFTAVMIAMVAIGV
FT                   EHPGGPVKATAETNLVTGFTAALNIILSYASHNAFFNVIAELKEPRDFPKALTLLQCID
FT                   ITLYLVSGVVIYYFAGDDVKSPALGSINPLVSKVAYGVALPTIIIAGVINGHIACKSIY
FT                   TRVFAGTSHMHKQDFRAVGSWIGIAVGLWVIAWVVATAIPVFSNLLSLMTALFASWFSF
FT                   SLPAAFWLFMNRGLWFSSPRKTGITIFNCLVFGMGVVMSLGTILLACICVSSGNGKSSS
FT                   "
     MPFHADIPQF QPTNDDIERT QAEKKHKETP TMAVDEQKAE SVPYRQDVFG DEEHAEVKYK        60
     VLKWWQCGLL MVAETISLGI LSIPAAIAGL GLVPAIVILL VMGLIASYTG YVIGQFKWRY       120
     PHVVSMADAG EVLMGRFGRE VLFGGQMLFL IFLMASHILT FTVAMNRLTN HGTCSLVFGV       180
     IGLLVSLVFS LPRTMKNMSW LSLASFISIF TAVMIAMVAI GVEHPGGPVK ATAETNLVTG       240
     FTAALNIILS YASHNAFFNV IAELKEPRDF PKALTLLQCI DITLYLVSGV VIYYFAGDDV       300
     KSPALGSINP LVSKVAYGVA LPTIIIAGVI NGHIACKSIY TRVFAGTSHM HKQDFRAVGS       360
     WIGIAVGLWV IAWVVATAIP VFSNLLSLMT ALFASWFSFS LPAAFWLFMN RGLWFSSPRK       420
     TGITIFNCLV FGMGVVMSLG TILLACICVS SGNGKSSS                               458
//

If you have problems or comments...

PBIL Back to PBIL home page