(data stored in ACNUC16935 zone)

EMBL: BN001307.PE292

BN001307.PE292       Location/Qualifiers
FT   CDS             join(797893..798006,798060..799475)
FT                   /locus_tag="ANIA_01461"
FT                   /old_locus_tag="AN1461.4"
FT                   /product="Protein OS-9 homolog Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDB9]"
FT                   /note="transcript_id=CADANIAT00008077"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008077"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008077"
FT                   /db_xref="GOA:Q5BDB9"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDB9"
FT                   /protein_id="CBF84906.1"
FT                   /translation="MRRQSRIVASLLVLACASSGAFAHRKFNVHDDLLAYPQFRIKFPD
FT                   GFILESQARAFLEQAPYSSPDLNDISEQTPLKDESEESIRDGSSGEKAKFSYEELSLEG
FT                   QRYLCQIPVVEDGDSNRTKVEVNEEEERKELARATDRGLELLREMEGKCLYYISGWWSY
FT                   SFCYMNQIKQFHALPSGGGVPNYPPMEDHTTHSFILGRFPQEEGQDEGKGAKSGKSSTE
FT                   LAELQTKGGSRYLVQRLESGDQCDLTGKNRKIEVQFHCNPQSTDRIAWIKELYTCSYLM
FT                   LIYTPRLCNDVAFLPPQQEEVHTIECREILTPEEVTGWQAMHEYQLSQQLVESAEAPKH
FT                   QVIGGIEVGAQRLVGTEGKRIEKGRVASIGEEKVDVVAKRVNGEVQLLSAEELKKFDLD
FT                   EAKIEELRKKLEEWAKGKDWTLEIVTGNGAYLRGVVDTDEDEEDGYENEEGETDKREQR
FT                   ENTQETTGQPGQPGHQEETESGQAGHPMDDRSEDGEDPDVDGSEEIFKDEL"
     MRRQSRIVAS LLVLACASSG AFAHRKFNVH DDLLAYPQFR IKFPDGFILE SQARAFLEQA        60
     PYSSPDLNDI SEQTPLKDES EESIRDGSSG EKAKFSYEEL SLEGQRYLCQ IPVVEDGDSN       120
     RTKVEVNEEE ERKELARATD RGLELLREME GKCLYYISGW WSYSFCYMNQ IKQFHALPSG       180
     GGVPNYPPME DHTTHSFILG RFPQEEGQDE GKGAKSGKSS TELAELQTKG GSRYLVQRLE       240
     SGDQCDLTGK NRKIEVQFHC NPQSTDRIAW IKELYTCSYL MLIYTPRLCN DVAFLPPQQE       300
     EVHTIECREI LTPEEVTGWQ AMHEYQLSQQ LVESAEAPKH QVIGGIEVGA QRLVGTEGKR       360
     IEKGRVASIG EEKVDVVAKR VNGEVQLLSA EELKKFDLDE AKIEELRKKL EEWAKGKDWT       420
     LEIVTGNGAY LRGVVDTDED EEDGYENEEG ETDKREQREN TQETTGQPGQ PGHQEETESG       480
     QAGHPMDDRS EDGEDPDVDG SEEIFKDEL                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page