(data stored in ACNUC16935 zone)

EMBL: BN001307.PE293

BN001307.PE293       Location/Qualifiers
FT   CDS             join(800254..800451,800623..801342,801380..801970,
FT                   802009..802057,802106..803890,803938..803963)
FT                   /locus_tag="ANIA_01462"
FT                   /old_locus_tag="AN1462.4"
FT                   /product="cytoskeleton assembly control protein Sla1,
FT                   putative (AFU_orthologue; AFUA_8G04520)"
FT                   /note="transcript_id=CADANIAT00008078"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008078"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008078"
FT                   /db_xref="GOA:Q5BDB8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB8"
FT                   /protein_id="CBF84908.1"
FT                   /translation="MGFIGVYTAIYDYQPQAQGELELREGDLLYILEKSDEDDWWKAKK
FT                   KADREDEDEPEGLVPNNYVEEATPIHTAKALYDYTRQTDEEVSFSEDANLVVYDTSDPD
FT                   WTLVGVNGDFGFAPSNYIDILDDSVAHAAPAQTSASPEPPSAAAASPASPAPAPAPPSL
FT                   PQRPEPAPAEEPSSPVSSSPSDAVQNPAAAAIASILHKQHASSESPRDVPPPPQPQPPS
FT                   EPQYREPSPPPPQLPRRPPSEQLTSPVHLESPTFAPSPVSHPRHASIRENDGGPRESPP
FT                   YNRVGRTAPRSPSGYHIYNINEMVEGSTSPPGTIFISPEDDGDVQEWSAEKLTHYSIEG
FT                   KHVFIDLVRPSKSVDFHAGAKDTAREIVSALGEISGAFRAEGLREVIAAGSGGGGAQKK
FT                   GTILYDFMAQGDDEVTVGVGDEVVIVDDTKSEEWWMVRRIKNGKEGVVPSSYVEVTGFV
FT                   SPPSTTTPAESGLSAVERNRLEEARLAKEATRKSVSEAAAPRSPTIKPQHHKKDSKSSQ
FT                   RSKPDPAKVRTWIDRSKAFTVEAQFIGLQDGKIHLHKTNGIKIAVPIPKMSFEDLEYVE
FT                   KVTGISLDEDKPLSDIRRRSQRIESDKADKARSSSEGKSGATFQQSDYDWFDFFLKAGV
FT                   GPHQCERYAQNFAKDSMDESILPDITPENLRTLGLKEGDILRVMRYLDNMLGRTGNKSK
FT                   LRNVSFGGEEVMGDGEESGGLFAGPGGALRNNTRKSRPAPAVQTNDVVDPKVFEQKDTA
FT                   KPDKPPSSGTPPPASAAAGDKPVQKGFDDDAWEVKTPKQPAAPATAVSSPPPAAAPATT
FT                   SPPAQPSITGAMADLSLLQAPLQPTLAQPTSTPAPAQSPPATQPIQAQPTAIPAPQPQQ
FT                   PGASPNFFAQVAQVGQQQPMQTGFQQSRQRPQAPQVMGQNSLIPPPPQRPLSAPQNMPQ
FT                   QQPFGLPQLQPQLTGLPQQGPQIAAPGQSLAEINQQRFQPSFQPQQTGFMAPNQFQNGL
FT                   MPQPTGFQPQSQFGIQQQQTGFGLAPQPTGFGGFGAPPQQPMPTGINSVLPPPLQPQPT
FT                   GMNGSGSMAYSPSPPPIPPIPQQQTLAPLQAQKTGPAPPVRFGVKPDAPKKLAPQPTGL
FT                   KANLSQATPTNPFGF"
     MGFIGVYTAI YDYQPQAQGE LELREGDLLY ILEKSDEDDW WKAKKKADRE DEDEPEGLVP        60
     NNYVEEATPI HTAKALYDYT RQTDEEVSFS EDANLVVYDT SDPDWTLVGV NGDFGFAPSN       120
     YIDILDDSVA HAAPAQTSAS PEPPSAAAAS PASPAPAPAP PSLPQRPEPA PAEEPSSPVS       180
     SSPSDAVQNP AAAAIASILH KQHASSESPR DVPPPPQPQP PSEPQYREPS PPPPQLPRRP       240
     PSEQLTSPVH LESPTFAPSP VSHPRHASIR ENDGGPRESP PYNRVGRTAP RSPSGYHIYN       300
     INEMVEGSTS PPGTIFISPE DDGDVQEWSA EKLTHYSIEG KHVFIDLVRP SKSVDFHAGA       360
     KDTAREIVSA LGEISGAFRA EGLREVIAAG SGGGGAQKKG TILYDFMAQG DDEVTVGVGD       420
     EVVIVDDTKS EEWWMVRRIK NGKEGVVPSS YVEVTGFVSP PSTTTPAESG LSAVERNRLE       480
     EARLAKEATR KSVSEAAAPR SPTIKPQHHK KDSKSSQRSK PDPAKVRTWI DRSKAFTVEA       540
     QFIGLQDGKI HLHKTNGIKI AVPIPKMSFE DLEYVEKVTG ISLDEDKPLS DIRRRSQRIE       600
     SDKADKARSS SEGKSGATFQ QSDYDWFDFF LKAGVGPHQC ERYAQNFAKD SMDESILPDI       660
     TPENLRTLGL KEGDILRVMR YLDNMLGRTG NKSKLRNVSF GGEEVMGDGE ESGGLFAGPG       720
     GALRNNTRKS RPAPAVQTND VVDPKVFEQK DTAKPDKPPS SGTPPPASAA AGDKPVQKGF       780
     DDDAWEVKTP KQPAAPATAV SSPPPAAAPA TTSPPAQPSI TGAMADLSLL QAPLQPTLAQ       840
     PTSTPAPAQS PPATQPIQAQ PTAIPAPQPQ QPGASPNFFA QVAQVGQQQP MQTGFQQSRQ       900
     RPQAPQVMGQ NSLIPPPPQR PLSAPQNMPQ QQPFGLPQLQ PQLTGLPQQG PQIAAPGQSL       960
     AEINQQRFQP SFQPQQTGFM APNQFQNGLM PQPTGFQPQS QFGIQQQQTG FGLAPQPTGF      1020
     GGFGAPPQQP MPTGINSVLP PPLQPQPTGM NGSGSMAYSP SPPPIPPIPQ QQTLAPLQAQ      1080
     KTGPAPPVRF GVKPDAPKKL APQPTGLKAN LSQATPTNPF GF                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page