(data stored in ACNUC16935 zone)

EMBL: BN001307.PE294

BN001307.PE294       Location/Qualifiers
FT   CDS             join(808460..808514,808570..808954,809003..809164,
FT                   809213..809365,809444..809566,809649..809868)
FT                   /locus_tag="ANIA_01463"
FT                   /old_locus_tag="AN1463.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008079"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008079"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB7"
FT                   /protein_id="CBF84910.1"
FT                   /translation="MQLFAHLLRVATALLLPIGTVAQECSSRENYTARNQTEIDTITQN
FT                   CTTIVGELGLVDWSGPLTLPNITRIRSIRVYSGDITAIELPALTYLGSDLLLTNLPSLR
FT                   RVSLPELQHIEGLYVDLVGNAPELHIPRLTNASSIYLRGNFSDQSFHSLRNVEKKLDIC
FT                   NAVSCGYYSRMNAFTSMRLSFPSLERAGSLIVGGNVSSLSLPELTTLTCNDCDWVALHL
FT                   KLYGSSRLPVNLPKLANTNGSLYIRGDIDSISLPSLREYNRELIMTPYEPLDITLPVER
FT                   AEDFSFTGNVSSLTDFTRIYINSDLDFDCDALWKDLEQTSGPLNESSKEEYFQCSVGVS
FT                   WQPGGSQAATAVAALGLGFVMGLLI"
     MQLFAHLLRV ATALLLPIGT VAQECSSREN YTARNQTEID TITQNCTTIV GELGLVDWSG        60
     PLTLPNITRI RSIRVYSGDI TAIELPALTY LGSDLLLTNL PSLRRVSLPE LQHIEGLYVD       120
     LVGNAPELHI PRLTNASSIY LRGNFSDQSF HSLRNVEKKL DICNAVSCGY YSRMNAFTSM       180
     RLSFPSLERA GSLIVGGNVS SLSLPELTTL TCNDCDWVAL HLKLYGSSRL PVNLPKLANT       240
     NGSLYIRGDI DSISLPSLRE YNRELIMTPY EPLDITLPVE RAEDFSFTGN VSSLTDFTRI       300
     YINSDLDFDC DALWKDLEQT SGPLNESSKE EYFQCSVGVS WQPGGSQAAT AVAALGLGFV       360
     MGLLI                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page