(data stored in ACNUC16935 zone)

EMBL: BN001307.PE296

BN001307.PE296       Location/Qualifiers
FT   CDS             complement(join(813061..813690,813743..813860,
FT                   813915..813952,814017..814259))
FT                   /locus_tag="ANIA_10197"
FT                   /old_locus_tag="AN10197.4"
FT                   /product="sulfonate biosynthesis enzyme, putative
FT                   (AFU_orthologue; AFUA_8G04550)"
FT                   /note="transcript_id=CADANIAT00008081"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008081"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008081"
FT                   /db_xref="GOA:C8VMD5"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMD5"
FT                   /protein_id="CBF84913.1"
FT                   /translation="MLSPITRATALSSGKAQGSTFQRAAAPMMWSKGFSTTAPGSKKAA
FT                   ILLQDKSNGFGFARSNPRPKKPRSQGVTEIRGPYYTVMGKRYLADILETMGTHVDGLKF
FT                   AGGSFSLFPEKPLRELIDLAHEHSVYVSTGGWAEHLLTHPDPTSVFDKYLTKCEDLGFV
FT                   MLNLVPFRVLTLHHRFDVIELSSGFLSIPEDDWLRLVDKVHSYGLKAKPELGIQFGAGG
FT                   DTSAAGLESLGTSDPGKLVNLGRKFLDAGVERLMIESEGITENVKSWRTDVVSKIMKEL
FT                   PPERVMFEAADPQVYTWYIREFGIDVNLFVDHSQIVQLSGLRHGIWGTADTFGRLVSFR
FT                   AE"
     MLSPITRATA LSSGKAQGST FQRAAAPMMW SKGFSTTAPG SKKAAILLQD KSNGFGFARS        60
     NPRPKKPRSQ GVTEIRGPYY TVMGKRYLAD ILETMGTHVD GLKFAGGSFS LFPEKPLREL       120
     IDLAHEHSVY VSTGGWAEHL LTHPDPTSVF DKYLTKCEDL GFVMLNLVPF RVLTLHHRFD       180
     VIELSSGFLS IPEDDWLRLV DKVHSYGLKA KPELGIQFGA GGDTSAAGLE SLGTSDPGKL       240
     VNLGRKFLDA GVERLMIESE GITENVKSWR TDVVSKIMKE LPPERVMFEA ADPQVYTWYI       300
     REFGIDVNLF VDHSQIVQLS GLRHGIWGTA DTFGRLVSFR AE                          342
//

If you have problems or comments...

PBIL Back to PBIL home page