(data stored in ACNUC16935 zone)

EMBL: BN001307.PE297

BN001307.PE297       Location/Qualifiers
FT   CDS             join(815973..816362,816442..816976,817028..817434)
FT                   /locus_tag="ANIA_01465"
FT                   /old_locus_tag="AN1465.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G04560)"
FT                   /note="transcript_id=CADANIAT00008082"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008082"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008082"
FT                   /db_xref="GOA:Q5BDB5"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB5"
FT                   /protein_id="CBF84915.1"
FT                   /translation="MGAGAILEPLVVIVLLFGGTWINRTAGSFPPSRRARRKSVDRYRG
FT                   VSPDSIESGLCSPTSKDGLLKDRPLSPASSHCGHESWRKRRIGILLWTTEVTSPNTVVF
FT                   QDRLLSRLLRKLPFLAECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALKLIEIEQ
FT                   ALGLFWEVPIQQFFLRHPLLMKWTNWIYSFIHIPGTIAFLVWLYYYTITRNHSDEPQSG
FT                   KPRGTASGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDEKVQGPEGKLAR
FT                   SFGFVDTVHGAEGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPAHHRVSTR
FT                   VRIGPFGAQIPSRQRLVCLFLGFAYPFMILAAIVATANHFILDAVAGAIVCTLGWKFNS
FT                   VLLNLLPVEDYFLWLVRIHKPEPAEMAGPLDLEEWTDEIEAETA"
     MGAGAILEPL VVIVLLFGGT WINRTAGSFP PSRRARRKSV DRYRGVSPDS IESGLCSPTS        60
     KDGLLKDRPL SPASSHCGHE SWRKRRIGIL LWTTEVTSPN TVVFQDRLLS RLLRKLPFLA       120
     ECWYWALVYW TYQLGRAFTA VTLQEGTVDV ARKHALKLIE IEQALGLFWE VPIQQFFLRH       180
     PLLMKWTNWI YSFIHIPGTI AFLVWLYYYT ITRNHSDEPQ SGKPRGTASG SPAGPLLYQA       240
     RRRTLAVCNL LAFVVFTLWP CMPPRLLSDE KVQGPEGKLA RSFGFVDTVH GAEGAGSVWT       300
     ENRFCNQYAA MPSLHFGYSL MIGLTIMTIP LPAHHRVSTR VRIGPFGAQI PSRQRLVCLF       360
     LGFAYPFMIL AAIVATANHF ILDAVAGAIV CTLGWKFNSV LLNLLPVEDY FLWLVRIHKP       420
     EPAEMAGPLD LEEWTDEIEA ETA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page