(data stored in ACNUC16935 zone)

EMBL: BN001307.PE298

BN001307.PE298       Location/Qualifiers
FT   CDS             join(819065..819230,819349..819826,819890..820250,
FT                   820300..820522,820572..821209)
FT                   /locus_tag="ANIA_01466"
FT                   /old_locus_tag="AN1466.4"
FT                   /product="PWWP domain protein (AFU_orthologue;
FT                   AFUA_8G04570)"
FT                   /note="transcript_id=CADANIAT00008083"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008083"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008083"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB4"
FT                   /protein_id="CBF84917.1"
FT                   /translation="MAEANTNSPAPAPDSGEAPVERASAELKASPQESASEPTKENTKK
FT                   DANGADGKPAESAPAQDDKKESSDDTADKTEAPAEPAEAKKSDEGAAASADAEPAAAPE
FT                   ANGAPSSTKKASSKRKSTGGDTKSKLNRKKSMSRITHLDAKAGEYYLARLRSFPPWPAV
FT                   ICDEEILPQSLLSSRPVTARRPDGTYREDYADGGKRVAERTFPVMFLQTNEFAWIPNTD
FT                   LSPLDPAACKDISEKGKSKALVAAYNVAAENHDLAYFKNMLADHQAAIQQEEEEREAQE
FT                   AAKAAAKAAKEAKKNKRKSMEVRDDVEMEDADEEKQPKSSKKRKKDAEAEGDDKPAKTP
FT                   KTGTKLKLTTPKNPAEEKKASGSAKAKQSTSKKGKKAAASEDSDESSPAPKEPEPKVNL
FT                   EEAKKKREREVLFIRHRLQKGFISRDHPPKEEEMSQMSGYFTKLEKLNDLEVSIIRETK
FT                   IHKVLRMIIKLPNIPRDEEFDFRKRALDILSKWKNVLDSDRATPSQEKEKEKEEKPKSN
FT                   GVHKEKEGSAEAPVKASESKSEKEDDTKLDTPDQDTPMPDADEKTEEAPAPAKGEDEKV
FT                   ESADAAGETGKSEKKETETDTEKPAEDKAEDKKADEKTAEAETAA"
     MAEANTNSPA PAPDSGEAPV ERASAELKAS PQESASEPTK ENTKKDANGA DGKPAESAPA        60
     QDDKKESSDD TADKTEAPAE PAEAKKSDEG AAASADAEPA AAPEANGAPS STKKASSKRK       120
     STGGDTKSKL NRKKSMSRIT HLDAKAGEYY LARLRSFPPW PAVICDEEIL PQSLLSSRPV       180
     TARRPDGTYR EDYADGGKRV AERTFPVMFL QTNEFAWIPN TDLSPLDPAA CKDISEKGKS       240
     KALVAAYNVA AENHDLAYFK NMLADHQAAI QQEEEEREAQ EAAKAAAKAA KEAKKNKRKS       300
     MEVRDDVEME DADEEKQPKS SKKRKKDAEA EGDDKPAKTP KTGTKLKLTT PKNPAEEKKA       360
     SGSAKAKQST SKKGKKAAAS EDSDESSPAP KEPEPKVNLE EAKKKREREV LFIRHRLQKG       420
     FISRDHPPKE EEMSQMSGYF TKLEKLNDLE VSIIRETKIH KVLRMIIKLP NIPRDEEFDF       480
     RKRALDILSK WKNVLDSDRA TPSQEKEKEK EEKPKSNGVH KEKEGSAEAP VKASESKSEK       540
     EDDTKLDTPD QDTPMPDADE KTEEAPAPAK GEDEKVESAD AAGETGKSEK KETETDTEKP       600
     AEDKAEDKKA DEKTAEAETA A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page