(data stored in ACNUC16935 zone)

EMBL: BN001307.PE299

BN001307.PE299       Location/Qualifiers
FT   CDS             complement(822856..824208)
FT                   /locus_tag="ANIA_01467"
FT                   /old_locus_tag="AN1467.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008084"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008084"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008084"
FT                   /db_xref="GOA:Q5BDB3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB3"
FT                   /protein_id="CBF84919.1"
FT                   /translation="MILSVRPSRACGSAGSSLQAIARENLTGILWSPAARSQSLRRLPQ
FT                   DRPPQPLQRTRLPFLQVHSSRAFHSTPKRDSYTPRISYRVAASSSGKSRRFLPTKNAYN
FT                   FNPELHDALGVAVDTQDPATKRKRRPDSGEDAFFVSTVGRRRDPSKDNTIAFAVADGVG
FT                   GWAESRVDPADFSHALCDYMAQTALDWDGPAEQLRAKYLLQAGYDRVVADETIPAGGST
FT                   ASVGIGLDDGRIELANLGDSGSVLLRQAAVHHYSIPQTHGFNTPYQLSIIPKRMRQQAS
FT                   IFGGGFLEDFPRDANTTTLHMHHGDVLMLATDGVFDNLNNQDILKLVTGRMIYTGAWRA
FT                   STSPNTGIIPADRETLDRLTGAEGVATLVPSAMPKSTSNKSTIVSNPNNHIYTLQSLLA
FT                   ASIAGEAKLASLDPRRDSPFAKEAQRYYPGDHYRGGKVDDIAVLVIIAVEE"
     MILSVRPSRA CGSAGSSLQA IARENLTGIL WSPAARSQSL RRLPQDRPPQ PLQRTRLPFL        60
     QVHSSRAFHS TPKRDSYTPR ISYRVAASSS GKSRRFLPTK NAYNFNPELH DALGVAVDTQ       120
     DPATKRKRRP DSGEDAFFVS TVGRRRDPSK DNTIAFAVAD GVGGWAESRV DPADFSHALC       180
     DYMAQTALDW DGPAEQLRAK YLLQAGYDRV VADETIPAGG STASVGIGLD DGRIELANLG       240
     DSGSVLLRQA AVHHYSIPQT HGFNTPYQLS IIPKRMRQQA SIFGGGFLED FPRDANTTTL       300
     HMHHGDVLML ATDGVFDNLN NQDILKLVTG RMIYTGAWRA STSPNTGIIP ADRETLDRLT       360
     GAEGVATLVP SAMPKSTSNK STIVSNPNNH IYTLQSLLAA SIAGEAKLAS LDPRRDSPFA       420
     KEAQRYYPGD HYRGGKVDDI AVLVIIAVEE                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page