(data stored in ACNUC16935 zone)

EMBL: BN001307.PE301

BN001307.PE301       Location/Qualifiers
FT   CDS             827175..828014
FT                   /locus_tag="ANIA_01469"
FT                   /old_locus_tag="AN1469.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_8G04610)"
FT                   /note="transcript_id=CADANIAT00008086"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008086"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008086"
FT                   /db_xref="GOA:Q5BDB1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB1"
FT                   /protein_id="CBF84923.1"
FT                   /translation="MATSLRAQRAFQRLTVSSTVQSQARPIHTTTRKLSTPTACFLCRL
FT                   RPSRPNRRTSAIFPSALFAQRTFTSTPSTLNSASSETLPVPNAPDTTNYYTIFPQTLPN
FT                   GPPPSSPFTIDVQALRREFFSLQNTLHPDKYPPGPTKTAAESLSAIINEAYRTLSDPLL
FT                   RAQYLLREFHGIDVTAEDGSGAGAQPLDPELLMEVMDVQEAIEEVGEGQEAVEKIAVMK
FT                   KENDERVKGCVQALAEAFDKGDVEGARGECVRLKFWVSVADGLREWEPGMGGIRLIH"
     MATSLRAQRA FQRLTVSSTV QSQARPIHTT TRKLSTPTAC FLCRLRPSRP NRRTSAIFPS        60
     ALFAQRTFTS TPSTLNSASS ETLPVPNAPD TTNYYTIFPQ TLPNGPPPSS PFTIDVQALR       120
     REFFSLQNTL HPDKYPPGPT KTAAESLSAI INEAYRTLSD PLLRAQYLLR EFHGIDVTAE       180
     DGSGAGAQPL DPELLMEVMD VQEAIEEVGE GQEAVEKIAV MKKENDERVK GCVQALAEAF       240
     DKGDVEGARG ECVRLKFWVS VADGLREWEP GMGGIRLIH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page