(data stored in ACNUC16935 zone)

EMBL: BN001307.PE302

BN001307.PE302       Location/Qualifiers
FT   CDS             join(829465..829473,829671..831071)
FT                   /locus_tag="ANIA_01470"
FT                   /old_locus_tag="AN1470.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008087"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008087"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB0"
FT                   /protein_id="CBF84924.1"
FT                   /translation="MEPSGLARHVSKPLDHLINSGKTRESKHQIAILEDEDVETFVAFC
FT                   EYAYTGNYAVPPPGSRENEIEPVSINHALNGAYPDTGSTSPAASWEKSPPKPKVPSEAC
FT                   PGNPDDSNDRDGVGDGDVEPRRDPSQQSSSKDRHVYHSTKSEYTAQNPVATPHDSDNSP
FT                   APWAEDPPTRGRRRRRGKKDQQGVTQDATSKLTPPCTPPGAAQVEPDMPAAEPSEEFPV
FT                   LPGAEQSTSQSPERPGRTLSNGANGSGFGGIRNQREESLTKSRVRPVIDTSFANQQFSP
FT                   RHEKGTTNLWEEFTGIDDSGFRPSFRTRSPNPPAGITLPYLIFHAKLYVFATRYLIPGL
FT                   AHLCLQKLHYDLLNLAFPDPDPENQYEEQLVLTTTKARMIVDLLNYTYTKTTRLEPITP
FT                   SSATQLRDNELRRLVVHYAACKVRDLAVYCPPVEPIAGAAFYPEQPSARGFRALLDTLP
FT                   ELASDLIYRMI"
     MEPSGLARHV SKPLDHLINS GKTRESKHQI AILEDEDVET FVAFCEYAYT GNYAVPPPGS        60
     RENEIEPVSI NHALNGAYPD TGSTSPAASW EKSPPKPKVP SEACPGNPDD SNDRDGVGDG       120
     DVEPRRDPSQ QSSSKDRHVY HSTKSEYTAQ NPVATPHDSD NSPAPWAEDP PTRGRRRRRG       180
     KKDQQGVTQD ATSKLTPPCT PPGAAQVEPD MPAAEPSEEF PVLPGAEQST SQSPERPGRT       240
     LSNGANGSGF GGIRNQREES LTKSRVRPVI DTSFANQQFS PRHEKGTTNL WEEFTGIDDS       300
     GFRPSFRTRS PNPPAGITLP YLIFHAKLYV FATRYLIPGL AHLCLQKLHY DLLNLAFPDP       360
     DPENQYEEQL VLTTTKARMI VDLLNYTYTK TTRLEPITPS SATQLRDNEL RRLVVHYAAC       420
     KVRDLAVYCP PVEPIAGAAF YPEQPSARGF RALLDTLPEL ASDLIYRMI                   469
//

If you have problems or comments...

PBIL Back to PBIL home page