(data stored in ACNUC16935 zone)

EMBL: BN001307.PE303

BN001307.PE303       Location/Qualifiers
FT   CDS             complement(join(832418..832426,832630..832986))
FT                   /locus_tag="ANIA_01471"
FT                   /old_locus_tag="AN1471.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008088"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008088"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008088"
FT                   /db_xref="GOA:Q5BDA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA9"
FT                   /protein_id="CBF84926.1"
FT                   /translation="MAPVCSASRLGDYGSVPSSTRQPAKTEIDNASSTGSSTAKLCGTD
FT                   PGAWAVATENETGGKEPSETIGDDWSSGYTLRTEHRARFNSQQPLTNPMRHNAPLIRPI
FT                   DFLGLWPEPDLRTRLVT"
     MAPVCSASRL GDYGSVPSST RQPAKTEIDN ASSTGSSTAK LCGTDPGAWA VATENETGGK        60
     EPSETIGDDW SSGYTLRTEH RARFNSQQPL TNPMRHNAPL IRPIDFLGLW PEPDLRTRLV       120
     T                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page