(data stored in ACNUC16935 zone)

EMBL: BN001307.PE304

BN001307.PE304       Location/Qualifiers
FT   CDS             835141..836328
FT                   /locus_tag="ANIA_01472"
FT                   /old_locus_tag="AN1472.4"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative (AFU_orthologue; AFUA_8G04630)"
FT                   /note="transcript_id=CADANIAT00008089"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008089"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008089"
FT                   /db_xref="GOA:Q5BDA8"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR030185"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA8"
FT                   /protein_id="CBF84928.1"
FT                   /translation="MFENVPLPQSPRSETSTIVGEEVEMKKGVQMTICERLHHFTWAWF
FT                   TLTMSTGGLALLISNQPFQFQGLREIGLAVYIIDLLFFALCCFLMALRFFLHGGFLKSL
FT                   RHEREGFFFPTFWLSVATIISGLYKFFGEDADESFQLALEVLFWIYCACTLTLAVVQYY
FT                   FVFSSHTYHLQTMMPSWILPIFPVMLSGTIASVIAEQQPARSAIPIVCAGITFQGLGFS
FT                   VAFMMYSHYIGRLMQAGLPHREHRPGMFICVGPPAFTALALVGMTAGLPEQFEILHDES
FT                   SIQDARIMTLIAVSAAVFLWALSLWFFCIAVIAVIRERPTAFHLSWWAMVFPNTGFTLA
FT                   TITLGNWLDSTGIKGVATAMSIGIICMFLFVLVSHVRAVIRQDIMYPGKDEDVSE"
     MFENVPLPQS PRSETSTIVG EEVEMKKGVQ MTICERLHHF TWAWFTLTMS TGGLALLISN        60
     QPFQFQGLRE IGLAVYIIDL LFFALCCFLM ALRFFLHGGF LKSLRHEREG FFFPTFWLSV       120
     ATIISGLYKF FGEDADESFQ LALEVLFWIY CACTLTLAVV QYYFVFSSHT YHLQTMMPSW       180
     ILPIFPVMLS GTIASVIAEQ QPARSAIPIV CAGITFQGLG FSVAFMMYSH YIGRLMQAGL       240
     PHREHRPGMF ICVGPPAFTA LALVGMTAGL PEQFEILHDE SSIQDARIMT LIAVSAAVFL       300
     WALSLWFFCI AVIAVIRERP TAFHLSWWAM VFPNTGFTLA TITLGNWLDS TGIKGVATAM       360
     SIGIICMFLF VLVSHVRAVI RQDIMYPGKD EDVSE                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page