(data stored in ACNUC16935 zone)

EMBL: BN001307.PE306

BN001307.PE306       Location/Qualifiers
FT   CDS             complement(839525..840736)
FT                   /locus_tag="ANIA_01474"
FT                   /old_locus_tag="AN1474.4"
FT                   /product="RNA-3'-phosphate cyclase family protein
FT                   (AFU_orthologue; AFUA_8G04640)"
FT                   /note="transcript_id=CADANIAT00008091"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008091"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008091"
FT                   /db_xref="GOA:Q5BDA6"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA6"
FT                   /protein_id="CBF84932.1"
FT                   /translation="MATTSQPPIKLTGHKNFVYRLVFSTLTGRTIHISQIRPSSPTNPG
FT                   LASHEISFLRLLEAVTNGSQMEISYTGTIIVYKPGLITGTASGVGASSGSVIRHEIPAG
FT                   CTRGVSYFLIPLCLLAPFSKAPIKVLFTGPGVITSSTPTGDMSVDSVRTAILPLFNQFG
FT                   IFNNIELRVLRRSNLGPNGRGGGGEVQLVFGHQVRLPKTLHLMNAGRIKRVRGVAYSVG
FT                   VSASNNARMIDTCRGVLNPLVPDTYIFSDVSSAPLVPAPERNNPSAKKKIGLGFGLSLV
FT                   AESSTGCLFSADVACPPSGGQPPEDIGKQCAYQLLETISKGGCVAPAAFPIMIGLMTMG
FT                   SEDVGRIQVGRDIIGDESSIQLARDLMKFGAPGWGLRDAGDESNDVIISVVGRGIGNVG
FT                   RKVA"
     MATTSQPPIK LTGHKNFVYR LVFSTLTGRT IHISQIRPSS PTNPGLASHE ISFLRLLEAV        60
     TNGSQMEISY TGTIIVYKPG LITGTASGVG ASSGSVIRHE IPAGCTRGVS YFLIPLCLLA       120
     PFSKAPIKVL FTGPGVITSS TPTGDMSVDS VRTAILPLFN QFGIFNNIEL RVLRRSNLGP       180
     NGRGGGGEVQ LVFGHQVRLP KTLHLMNAGR IKRVRGVAYS VGVSASNNAR MIDTCRGVLN       240
     PLVPDTYIFS DVSSAPLVPA PERNNPSAKK KIGLGFGLSL VAESSTGCLF SADVACPPSG       300
     GQPPEDIGKQ CAYQLLETIS KGGCVAPAAF PIMIGLMTMG SEDVGRIQVG RDIIGDESSI       360
     QLARDLMKFG APGWGLRDAG DESNDVIISV VGRGIGNVGR KVA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page