(data stored in ACNUC16935 zone)

EMBL: BN001307.PE309

BN001307.PE309       Location/Qualifiers
FT   CDS             join(845543..845662,845716..846325,846372..846901)
FT                   /locus_tag="ANIA_10193"
FT                   /old_locus_tag="AN10193.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (AFU_orthologue; AFUA_8G04670)"
FT                   /note="transcript_id=CADANIAT00008094"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008094"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008094"
FT                   /db_xref="GOA:C8VME8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8VME8"
FT                   /protein_id="CBF84937.1"
FT                   /translation="MAQYFFDLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSY
FT                   VYLVQDKSTSELFALKKIRCPFGQESVSQALKEVEAYSLFTSEKNIIHSIDHCVSTESG
FT                   SKFRSDGGEAGSKTVYILLPYYQRGNLQDAINANLVNQTRFPEKRLMVLMLGVAQALRA
FT                   MHQYRVKSGSGPTRKAKAVRKEGAEADVEMRKGKGKRRGSQPAGEEDSENEPLMDDEVT
FT                   QSQEGYEDGNLRPYAHRDIKPGNIMIDDDGQSPILMDLGSLAPSPIAITSRSLALAVQD
FT                   TAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLS
FT                   MCVLGGDWRFPDEKSGATKGKGKASEQQKQDSAASISSPVKEVVRRCLQVEPADRPDID
FT                   ELIQMLKEVIRELPDDDVVG"
     MAQYFFDLLY NFTDCMCCFP SSPQLKINNR SFKLLRLLGE GGFSYVYLVQ DKSTSELFAL        60
     KKIRCPFGQE SVSQALKEVE AYSLFTSEKN IIHSIDHCVS TESGSKFRSD GGEAGSKTVY       120
     ILLPYYQRGN LQDAINANLV NQTRFPEKRL MVLMLGVAQA LRAMHQYRVK SGSGPTRKAK       180
     AVRKEGAEAD VEMRKGKGKR RGSQPAGEED SENEPLMDDE VTQSQEGYED GNLRPYAHRD       240
     IKPGNIMIDD DGQSPILMDL GSLAPSPIAI TSRSLALAVQ DTAAEHSTMP YRAPELFDVK       300
     TGSIIDTKVD IWSLGCTLYA CLVGKSPFEA RSEETGGSLS MCVLGGDWRF PDEKSGATKG       360
     KGKASEQQKQ DSAASISSPV KEVVRRCLQV EPADRPDIDE LIQMLKEVIR ELPDDDVVG        419
//

If you have problems or comments...

PBIL Back to PBIL home page