(data stored in ACNUC16935 zone)

EMBL: BN001307.PE31

BN001307.PE31        Location/Qualifiers
FT   CDS             join(87193..87466,87519..88132)
FT                   /locus_tag="ANIA_09031"
FT                   /old_locus_tag="AN9031.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_4G01490)"
FT                   /note="transcript_id=CADANIAT00007822"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007822"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007822"
FT                   /db_xref="GOA:Q5ARP9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP9"
FT                   /protein_id="CBF84427.1"
FT                   /translation="MCPIEICWTHLVRYSSTANGPIKYGEPILGQTGDIGKLARDDQLK
FT                   VKRLLGSDPFLLEKTDVVETVYRLYGPLEPKDVPIIRCIGLNYKTHILETGRPLPTCPT
FT                   VFTKPSPAVADHDAPVPIPKIAQEQCDYEGELVIVIGREGKNIPEAEALNYVAAYTAGN
FT                   DISARDWQREAGKAGPVPQWTFSKSFDNYAPLGPCLVRQDQLNEASMLSLRTLVNGDVR
FT                   QESHTSDLCFGVRKLVAFCSQGQTLQRGSLIMTGTPGGVGLFMKPPQFLKDGDVVSVEI
FT                   ESIGTLQNTISFEN"
     MCPIEICWTH LVRYSSTANG PIKYGEPILG QTGDIGKLAR DDQLKVKRLL GSDPFLLEKT        60
     DVVETVYRLY GPLEPKDVPI IRCIGLNYKT HILETGRPLP TCPTVFTKPS PAVADHDAPV       120
     PIPKIAQEQC DYEGELVIVI GREGKNIPEA EALNYVAAYT AGNDISARDW QREAGKAGPV       180
     PQWTFSKSFD NYAPLGPCLV RQDQLNEASM LSLRTLVNGD VRQESHTSDL CFGVRKLVAF       240
     CSQGQTLQRG SLIMTGTPGG VGLFMKPPQF LKDGDVVSVE IESIGTLQNT ISFEN            295
//

If you have problems or comments...

PBIL Back to PBIL home page