(data stored in ACNUC16935 zone)

EMBL: BN001307.PE312

BN001307.PE312       Location/Qualifiers
FT   CDS             complement(853194..854396)
FT                   /locus_tag="ANIA_10199"
FT                   /old_locus_tag="AN10199.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008097"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008097"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008097"
FT                   /db_xref="GOA:C8VMF1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF1"
FT                   /protein_id="CBF84943.1"
FT                   /translation="MDNHKKDKFSHCPESHPIPPRTPTLSPSRDEPNGLPLPDHIDEML
FT                   ENAQQSPIESEIMGERLHRAEQIEIEQQEGQPKLEPQSWCPPSSAGESRELPTAAAAID
FT                   HMIEHPRNSRCEAEEIRKLLQGRGEITRLAQQAKRIVSNTRNRWLAIGQHIHRDPKHQD
FT                   TLSEGLNRLEAVRQGIEDCTRRIEARLRQYHTQERQQRLRRRLQRRQQRRQVQQITSYL
FT                   QQSGFDLGLELSYDGPSQSASNSVLEFHPEFQNKIAHLARKLHPLVSYSTGLIHPYFPK
FT                   SVLAFNLLTSAQLDALALHFHQVYPPRRETFLYPLPIKPWLATNGFLRDLGVDTEVKRR
FT                   RFGRFIGLKGCESPVKTRSDEGSVVEQVERDWERRYRNALAVQMRNVEESYMFMDGLDN
FT                   V"
     MDNHKKDKFS HCPESHPIPP RTPTLSPSRD EPNGLPLPDH IDEMLENAQQ SPIESEIMGE        60
     RLHRAEQIEI EQQEGQPKLE PQSWCPPSSA GESRELPTAA AAIDHMIEHP RNSRCEAEEI       120
     RKLLQGRGEI TRLAQQAKRI VSNTRNRWLA IGQHIHRDPK HQDTLSEGLN RLEAVRQGIE       180
     DCTRRIEARL RQYHTQERQQ RLRRRLQRRQ QRRQVQQITS YLQQSGFDLG LELSYDGPSQ       240
     SASNSVLEFH PEFQNKIAHL ARKLHPLVSY STGLIHPYFP KSVLAFNLLT SAQLDALALH       300
     FHQVYPPRRE TFLYPLPIKP WLATNGFLRD LGVDTEVKRR RFGRFIGLKG CESPVKTRSD       360
     EGSVVEQVER DWERRYRNAL AVQMRNVEES YMFMDGLDNV                             400
//

If you have problems or comments...

PBIL Back to PBIL home page