(data stored in ACNUC16935 zone)

EMBL: BN001307.PE313

BN001307.PE313       Location/Qualifiers
FT   CDS             complement(join(854816..856973,857037..857068))
FT                   /locus_tag="ANIA_10198"
FT                   /old_locus_tag="AN10198.4"
FT                   /product="oligopeptidase family protein (AFU_orthologue;
FT                   AFUA_8G04730)"
FT                   /note="transcript_id=CADANIAT00008098"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008098"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008098"
FT                   /db_xref="GOA:C8VMF2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF2"
FT                   /protein_id="CBF84945.1"
FT                   /translation="MTIRSMKFTPEVLLGAPRRSGAVPNSTGTLAVYTQTTYSFESHSK
FT                   TNEIRVLDLKTGRSALITNDPGASSPQWIDNTDQLIWLKSKGNGNTSLIIGDARQADRT
FT                   YTAGTVPGPVSDLKVTVIESGKIGFAVAGKSNPDGTLYNPQDAKAPHSTGKLYTSLFVR
FT                   HWDSYIEPQRNAIFFGLLQRAPLSPATRQAGKYSVSGITNLIAVCGLTGVESPIPPFGG
FT                   GGDFAVSPSAIVFVARDPDVNPALHTACSCYYCPMFSWTGVSAVESRICRVQGLEGAMS
FT                   SPVLSSDGSSIAVLAMRQDGYESDKNRILYVPNPWSGEMIEAFASANGKGLWNLSPSGL
FT                   TFSNDDNYLYIQAEEYGRGVLFRLPVANIRHSTPNMLKKITSSGYVTDVHPVTSKSSHL
FT                   LISSNSLVDNSIWTVVDPANPADAHVISSIGHGGAAFGLSAAQVDEIWYRGAEDTPIHA
FT                   WVVKPSNFRPGSKYPLAFLVHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPNPRGSTGY
FT                   GQEFTDAIRGSWGGLPYIDLEKGFDYIEKNLKYVDTNRAVALGASYGGYMMNWIQGQPL
FT                   GRRFRALVTHDGVFSTTSLLATEELYFPLHDLKGVQWIVPENWAQWDPSRHLDKWQTPH
FT                   LIIHNEKDYRLTIAEGLSAFNVLQMKGIDSAFLTFPDENHWVLNPENALMWHYTIFNWI
FT                   NKHVGLPAASERFEQFSGNEKVALQNRLAKVSLSN"
     MTIRSMKFTP EVLLGAPRRS GAVPNSTGTL AVYTQTTYSF ESHSKTNEIR VLDLKTGRSA        60
     LITNDPGASS PQWIDNTDQL IWLKSKGNGN TSLIIGDARQ ADRTYTAGTV PGPVSDLKVT       120
     VIESGKIGFA VAGKSNPDGT LYNPQDAKAP HSTGKLYTSL FVRHWDSYIE PQRNAIFFGL       180
     LQRAPLSPAT RQAGKYSVSG ITNLIAVCGL TGVESPIPPF GGGGDFAVSP SAIVFVARDP       240
     DVNPALHTAC SCYYCPMFSW TGVSAVESRI CRVQGLEGAM SSPVLSSDGS SIAVLAMRQD       300
     GYESDKNRIL YVPNPWSGEM IEAFASANGK GLWNLSPSGL TFSNDDNYLY IQAEEYGRGV       360
     LFRLPVANIR HSTPNMLKKI TSSGYVTDVH PVTSKSSHLL ISSNSLVDNS IWTVVDPANP       420
     ADAHVISSIG HGGAAFGLSA AQVDEIWYRG AEDTPIHAWV VKPSNFRPGS KYPLAFLVHG       480
     GPQGAWNDQW STRWNPAVFA EQGYVVITPN PRGSTGYGQE FTDAIRGSWG GLPYIDLEKG       540
     FDYIEKNLKY VDTNRAVALG ASYGGYMMNW IQGQPLGRRF RALVTHDGVF STTSLLATEE       600
     LYFPLHDLKG VQWIVPENWA QWDPSRHLDK WQTPHLIIHN EKDYRLTIAE GLSAFNVLQM       660
     KGIDSAFLTF PDENHWVLNP ENALMWHYTI FNWINKHVGL PAASERFEQF SGNEKVALQN       720
     RLAKVSLSN                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page