(data stored in ACNUC16935 zone)

EMBL: BN001307.PE315

BN001307.PE315       Location/Qualifiers
FT   CDS             join(864548..864907,864952..865741,865955..867579)
FT                   /locus_tag="ANIA_01479"
FT                   /old_locus_tag="AN1479.4"
FT                   /product="DNA-binding protein of the mitochondria
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008100"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008100"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008100"
FT                   /db_xref="GOA:Q5BDA1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA1"
FT                   /protein_id="CBF84949.1"
FT                   /translation="MPVNGSRLPYLVQSQARSLARPNTILPYRCLVHRTICHHAQPRRV
FT                   AAPQLTTVFHNQRRSAKTKSTVKLKDLPQGAVKLEPYQDVVEDTPRYPTVVQGHRNNMQ
FT                   KFKNCVVLTRVGGFYELYFEQAEELAPLLNLKLATKKTSAGPVPMAGFPFFQLDRFLKI
FT                   LVQDLNKFVAISEEFAISAEEKARSGMLFDRKVARVITPGTLIDEKFMDPSENNFLMAI
FT                   YLNPSDLGMHARGSDESSYQHILTSASQNVGLAWLDLSTGDFYTQSTTAQMLPSAIARI
FT                   GAREILVDQRLQDLAGQELQLLIGHEHRLMTCFSFPEKISPVSDWASMLEAPLPSTSID
FT                   AFSQEEVAAGYSLLEYIRVQLQGLNLKLQPPRRRHLNESMSIDLQLLKRSYDAQRLVQK
FT                   FTLGKGDADDLICLSKSIEASKNVKRLLSAASNASSEYSRKSLQKMVDQLYLDGPTLLA
FT                   DKILSAIDEEGLLQKQRIEEDTAAEAAILAQEVTLNEGAAADLASLPKKVREKTTERTA
FT                   TDESSPDETWIMRRDASPALKELHRTLDELQNEKSKLGQYLRDSVGSSAITLKWTPGLG
FT                   HICHVKGAKVSQQQLEDIGVTRNVSSTKSTRSFYLPAWTELGGRMDQIKVQIRQEEQAI
FT                   FEQLRREVILNLVKIRRNASVMDELDVACSFATLAAEQQLVRPILTEGTNYKIIGGRHP
FT                   TVKLGLEEQGRRFVSNDCFLGESERIWLITGPNMAGKSTFLRQNALITILAQVGSFVPA
FT                   DYAEIGIVDQIFSRIGAADDLFRDQSTFMVEMLETAAILKQATARSFVIMDEVGRGTTP
FT                   EDGTAVSFACLHHLHYRNQCRTLFATHFHGLADMTQEFPALGRYCTDVKETTEGRFSFV
FT                   HKLRKGINRESHALKVAQLAGLPSETLELARSVRDSIRGEASRLTTAAFSSAS"
     MPVNGSRLPY LVQSQARSLA RPNTILPYRC LVHRTICHHA QPRRVAAPQL TTVFHNQRRS        60
     AKTKSTVKLK DLPQGAVKLE PYQDVVEDTP RYPTVVQGHR NNMQKFKNCV VLTRVGGFYE       120
     LYFEQAEELA PLLNLKLATK KTSAGPVPMA GFPFFQLDRF LKILVQDLNK FVAISEEFAI       180
     SAEEKARSGM LFDRKVARVI TPGTLIDEKF MDPSENNFLM AIYLNPSDLG MHARGSDESS       240
     YQHILTSASQ NVGLAWLDLS TGDFYTQSTT AQMLPSAIAR IGAREILVDQ RLQDLAGQEL       300
     QLLIGHEHRL MTCFSFPEKI SPVSDWASML EAPLPSTSID AFSQEEVAAG YSLLEYIRVQ       360
     LQGLNLKLQP PRRRHLNESM SIDLQLLKRS YDAQRLVQKF TLGKGDADDL ICLSKSIEAS       420
     KNVKRLLSAA SNASSEYSRK SLQKMVDQLY LDGPTLLADK ILSAIDEEGL LQKQRIEEDT       480
     AAEAAILAQE VTLNEGAAAD LASLPKKVRE KTTERTATDE SSPDETWIMR RDASPALKEL       540
     HRTLDELQNE KSKLGQYLRD SVGSSAITLK WTPGLGHICH VKGAKVSQQQ LEDIGVTRNV       600
     SSTKSTRSFY LPAWTELGGR MDQIKVQIRQ EEQAIFEQLR REVILNLVKI RRNASVMDEL       660
     DVACSFATLA AEQQLVRPIL TEGTNYKIIG GRHPTVKLGL EEQGRRFVSN DCFLGESERI       720
     WLITGPNMAG KSTFLRQNAL ITILAQVGSF VPADYAEIGI VDQIFSRIGA ADDLFRDQST       780
     FMVEMLETAA ILKQATARSF VIMDEVGRGT TPEDGTAVSF ACLHHLHYRN QCRTLFATHF       840
     HGLADMTQEF PALGRYCTDV KETTEGRFSF VHKLRKGINR ESHALKVAQL AGLPSETLEL       900
     ARSVRDSIRG EASRLTTAAF SSAS                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page