(data stored in ACNUC16935 zone)

EMBL: BN001307.PE319

BN001307.PE319       Location/Qualifiers
FT   CDS             complement(join(875188..875231,875300..875510,
FT                   875567..875780,875882..875908,875973..876088,
FT                   876140..876154))
FT                   /locus_tag="ANIA_01483"
FT                   /old_locus_tag="AN1483.4"
FT                   /product="peroxisomal membrane protein (PmpP24), putative
FT                   (AFU_orthologue; AFUA_8G04780)"
FT                   /note="transcript_id=CADANIAT00008104"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008104"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008104"
FT                   /db_xref="InterPro:IPR019531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD97"
FT                   /protein_id="CBF84956.1"
FT                   /translation="MDALVSRLDALVTNADLAPLLSLVKGIRNGAVYGAKVRFPHALVM
FT                   IFLFRSGTIREKVKLVLNATRQHARNLAVFCFIYKSSMIVLRNLNPAGVGKEGHYDSFL
FT                   AGLLGGYAVFGRHKSSITQQIVIYIFARVVLGFAKLSVQPGMHPLSSLIGPEARKQIES
FT                   NAWAVFASLSWASVMYLFRWHPEVLMSSLRSNIPTQITGTRSATS"
     MDALVSRLDA LVTNADLAPL LSLVKGIRNG AVYGAKVRFP HALVMIFLFR SGTIREKVKL        60
     VLNATRQHAR NLAVFCFIYK SSMIVLRNLN PAGVGKEGHY DSFLAGLLGG YAVFGRHKSS       120
     ITQQIVIYIF ARVVLGFAKL SVQPGMHPLS SLIGPEARKQ IESNAWAVFA SLSWASVMYL       180
     FRWHPEVLMS SLRSNIPTQI TGTRSATS                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page