(data stored in ACNUC16935 zone)

EMBL: BN001307.PE320

BN001307.PE320       Location/Qualifiers
FT   CDS             complement(join(876531..877512,877621..877634))
FT                   /locus_tag="ANIA_10200"
FT                   /old_locus_tag="AN10200.4"
FT                   /product="ribosome biogenesis protein, putative
FT                   (AFU_orthologue; AFUA_8G04790)"
FT                   /note="transcript_id=CADANIAT00008105"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008105"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008105"
FT                   /db_xref="GOA:C8VMF9"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="PDB:4XD9"
FT                   /db_xref="PDB:5BY8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF9"
FT                   /protein_id="CBF84958.1"
FT                   /translation="MLREVKPKNPRTARILKAKEPQLIEGAKRVLLLHGSKCPTPLHTV
FT                   LKVFHSLTTPHSVLFHKKNENIHPFESTESLEFLANKNDCGMVIFGSSNKKRPNCLTIA
FT                   RIFDSKVLDMAELLLLPDANGEGIPEMNRLSMHVAIGLRPLMLFSGSAWDDTTSTTHTM
FT                   LKSMLVDLFKGETSDKIDVEGLQYALMVGAEEPTAGLAPIIHLRWYKIVTKRSGHKLPR
FT                   VELEEIGPKLDFKVGRIQEAPRDVMKEAMKQGKKPNEEIKNKKNIGIDLIGDKVGRVHL
FT                   AKQDLGGLQTRKMKGLKRRAGVESDDEGDADMMDVDEVSEDEKTKRARHD"
     MLREVKPKNP RTARILKAKE PQLIEGAKRV LLLHGSKCPT PLHTVLKVFH SLTTPHSVLF        60
     HKKNENIHPF ESTESLEFLA NKNDCGMVIF GSSNKKRPNC LTIARIFDSK VLDMAELLLL       120
     PDANGEGIPE MNRLSMHVAI GLRPLMLFSG SAWDDTTSTT HTMLKSMLVD LFKGETSDKI       180
     DVEGLQYALM VGAEEPTAGL APIIHLRWYK IVTKRSGHKL PRVELEEIGP KLDFKVGRIQ       240
     EAPRDVMKEA MKQGKKPNEE IKNKKNIGID LIGDKVGRVH LAKQDLGGLQ TRKMKGLKRR       300
     AGVESDDEGD ADMMDVDEVS EDEKTKRARH D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page