(data stored in ACNUC16935 zone)

EMBL: BN001307.PE322

BN001307.PE322       Location/Qualifiers
FT   CDS             complement(join(882347..882439,882493..882912,
FT                   882961..883334,883396..883510))
FT                   /locus_tag="ANIA_01485"
FT                   /old_locus_tag="AN1485.4"
FT                   /product="casein kinase II (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008107"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008107"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008107"
FT                   /db_xref="GOA:Q5BD95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD95"
FT                   /protein_id="CBF84962.1"
FT                   /translation="MARVYADVNKHMPRSYWDYDSVNISWGVLENYEVVRKIGRGKYSE
FT                   VFEGINIVNYQKCVIKVLKPVKKKKIKREIKILQNLAGGPNVVALLDVVRDNQSKTPSL
FT                   VFEYVNNTDFRTLYPRFSDYDVRFYIYELLKALDFCHSKGIMHRDVKPHNVMIDHEKRK
FT                   LRLIDWGLAEFYHKGTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSLGAMFASMIFRK
FT                   EPFFHGNSNSDQLVKIAKVLGTEELFEYLDKYEIELDPQYDEILSRFPRKPWQSFVNAE
FT                   NQRFISDEAIDFLDKLLRYDHAERLTAQEAMAHPYFAQIRAEEAANRSTASS"
     MARVYADVNK HMPRSYWDYD SVNISWGVLE NYEVVRKIGR GKYSEVFEGI NIVNYQKCVI        60
     KVLKPVKKKK IKREIKILQN LAGGPNVVAL LDVVRDNQSK TPSLVFEYVN NTDFRTLYPR       120
     FSDYDVRFYI YELLKALDFC HSKGIMHRDV KPHNVMIDHE KRKLRLIDWG LAEFYHKGTE       180
     YNVRVASRYF KGPELLVDFQ EYDYSLDMWS LGAMFASMIF RKEPFFHGNS NSDQLVKIAK       240
     VLGTEELFEY LDKYEIELDP QYDEILSRFP RKPWQSFVNA ENQRFISDEA IDFLDKLLRY       300
     DHAERLTAQE AMAHPYFAQI RAEEAANRST ASS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page